SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000001160 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000001160
Domain Number 1 Region: 30-93
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000167
Family Complement control module/SCR domain 0.00032
Further Details:      
 
Domain Number 2 Region: 91-156
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000297
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 3 Region: 283-345
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000584
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 4 Region: 340-398
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000236
Family Complement control module/SCR domain 0.00094
Further Details:      
 
Domain Number 5 Region: 156-225
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000351
Family Complement control module/SCR domain 0.0024
Further Details:      
 
Domain Number 6 Region: 217-279
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000114
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 7 Region: 1-41
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000959
Family Complement control module/SCR domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000001160   Gene: ENSNLEG00000000986   Transcript: ENSNLET00000001227
Sequence length 454
Comment pep:known_by_projection supercontig:Nleu1.0:GL397352.1:1052467:1073720:1 gene:ENSNLEG00000000986 transcript:ENSNLET00000001227 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FFLIGSTTSHCEVQDRGVGWSHPLPQCEIVKCEPPPDIRNGRHSGEENFYAYGFSVTYSC
DPRFSLLGHASISCAVENETIGVWRPSPPTCEKITCHKPDVSHGKIVSGFGPIYNYKDSI
VFNCQKGFVLRGSSVIHCDADSKWNPSPPACEPNSCTNLTDIPHASWETYPRPTKEDVYV
VGTVLRYRCHPGYKPTTDAPTTVICQKNLRWTPYQGCEALCCPEPKLNNGEITQHRKSRT
ANHCVYFYGDEISFSCHEISRFSAICQADGTWSPRTPSCGDNCDFPPKIAHGHYKPPSLY
SLFKEEITYECDKGYILVGQAKLSCSYSRWSAPAPQCKALCLKPELVNGRLSVDKNQYVE
SENVTIQCDSGYGVVGPQSITCSENRTWYPEVPRCEWETPEGCEQVLTGKRLMQCLPNPE
DVKMALEVYKLSLEIEQLELQRDRARQSTLDEEL
Download sequence
Identical sequences G1QJR5
ENSNLEP00000001160 ENSNLEP00000001160

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]