SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000001162 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000001162
Domain Number 1 Region: 29-119
Classification Level Classification E-value
Superfamily Immunoglobulin 9.47e-21
Family I set domains 0.025
Further Details:      
 
Domain Number 2 Region: 148-239
Classification Level Classification E-value
Superfamily Immunoglobulin 1.22e-20
Family I set domains 0.0057
Further Details:      
 
Domain Number 3 Region: 245-363
Classification Level Classification E-value
Superfamily Immunoglobulin 1.83e-16
Family I set domains 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000001162   Gene: ENSNLEG00000000991   Transcript: ENSNLET00000001229
Sequence length 376
Comment pep:known_by_projection supercontig:Nleu1.0:GL397499.1:1043964:1056682:1 gene:ENSNLEG00000000991 transcript:ENSNLET00000001229 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTPSPLLLLLLLPPLLLGAFPRAAAARGPPRMADKVIPRQVARLGRTVRLQCPVEGDPPP
LTMWTKDGRTIHSGWSRFRVLPQGLKVKQVEQEDAGVYVCKATNGFGSVSVNYTLVVLDD
ISPGKESLGPDSSSGGQEDPAGQQWARPRFTQPSKMRRRVIARPVGSSVRLKCVASGHPR
PDITWMKDDQALMHPEAAEPRKKKWTLSLKNLRPEDSGKYTCRVSNRAGAINATYKVDVI
QRTRSKPVLTGTHPVNTTVDFGGTTSFQCKVRSDVKPVIQWLKRVEYGAEGRHNSTIDVG
GQKFVVLPTGDVWSRPDGSYLNKLLITRARQDDAGMYICLGANTMGYSFRSAFLTVLPDP
KPPGPPVASSSSATSL
Download sequence
Identical sequences ENSNLEP00000001162 XP_012355136.1.23891 ENSNLEP00000001162

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]