SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000001202 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSNLEP00000001202
Domain Number - Region: 67-102
Classification Level Classification E-value
Superfamily RING/U-box 0.0706
Family RING finger domain, C3HC4 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000001202   Gene: ENSNLEG00000001023   Transcript: ENSNLET00000001270
Sequence length 157
Comment pep:known_by_projection supercontig:Nleu1.0:GL397309.1:2949013:3010975:1 gene:ENSNLEG00000001023 transcript:ENSNLET00000001270 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSQKGNVARSRPQKHQNTFSFKNDKFDKSVQTKKINAKLHDGVCQRCKEVLEWRVKYSK
YKPLSKPKKCVKCLQKTVKDSYHIMCRPCACELEVCAKCGKKEDIVIPLNKETEKIEHTE
NNLSSNHRRSCRRNEESDDDLDFDIDLEDTGGEHQMN
Download sequence
Identical sequences A0A2I3FSP9
XP_003267453.1.23891 ENSNLEP00000001202

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]