SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000001225 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000001225
Domain Number 1 Region: 111-146
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000000000144
Family CCCH zinc finger 0.00033
Further Details:      
 
Domain Number 2 Region: 151-183
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000000000183
Family CCCH zinc finger 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000001225   Gene: ENSNLEG00000001046   Transcript: ENSNLET00000001296
Sequence length 338
Comment pep:known_by_projection supercontig:Nleu1.0:GL397292.1:3133296:3138418:-1 gene:ENSNLEG00000001046 transcript:ENSNLET00000001296 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTTLVSATIFDLSEVLCKGNKMLNYSAPSAGGCLLDRKAVGTPAGGGFPRRHSVTLPSS
KFHQNQLLSSLKGEPAPALSSRDSRFRDRSFSEGGERLLPTQKQPGGGQVNSSRYKTELC
RPFEENGACKYGDKCQFAHGIHELRSLTRHPKYKTELCRTFHTIGFCPYGPRCHFIHNAE
ERRALAGARDLSADRPRLQHSFSFAGFPSAAATAAATGLLDSPTSITPPPIMSADDLLGS
PTLPDGTNNPFAFSSQELASLFAPSMGLPGGGSPTTFLFRPMSESPHMFDSPPSPQDSLS
DQEGYLSSSSSSHSGSDSPTLDNSRRLPIFSRLSISDD
Download sequence
Identical sequences G1QJY0
XP_004087218.1.23891 XP_012359868.1.23891 XP_012359869.1.23891 ENSNLEP00000001225 ENSNLEP00000001225

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]