SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000001285 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000001285
Domain Number 1 Region: 716-992
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.55e-78
Family Protein kinases, catalytic subunit 0.000000000763
Further Details:      
 
Domain Number 2 Region: 337-525
Classification Level Classification E-value
Superfamily L domain-like 1.87e-42
Family L domain 0.000000324
Further Details:      
 
Domain Number 3 Region: 47-214
Classification Level Classification E-value
Superfamily L domain-like 3.4e-42
Family L domain 0.000000415
Further Details:      
 
Domain Number 4 Region: 511-642
Classification Level Classification E-value
Superfamily Growth factor receptor domain 3.77e-22
Family Growth factor receptor domain 0.000000116
Further Details:      
 
Domain Number 5 Region: 189-343
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.33e-16
Family Growth factor receptor domain 0.0000000145
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000001285   Gene: ENSNLEG00000000989   Transcript: ENSNLET00000001361
Sequence length 1255
Comment pep:known_by_projection supercontig:Nleu1.0:GL397430.1:1538073:1566947:1 gene:ENSNLEG00000000989 transcript:ENSNLET00000001361 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELAALCGWGLLLALLPPGAASTQVCTGTDMKLRLPASPETHLDMLRHLYQGCQVVQGNL
ELTYLPTNASLSFLQDIQEVQGYVLIAHNQVRQVPLQRLRIVRGTQLFEDNYALAVLDNG
DPLNNTTLVTGASPGGLRELQLRSLTEILKGGVLIQRNPQLCYQDTILWKDIFHKNNQLA
LTLIDTNRSRACQPCSPVCKGSRCWGESSEDCQSLTRTVCAGGCARCKGPLPTDCCHEQC
AAGCTGPKHSDCLACLHFNHSGICELHCPALVTYNTDTFESMPNPEGRYTFGASCVTACP
YNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARVCYGLGMEHLREVRAVTSAN
IQEFAGCKKIFGSLAFLPESFDGDPASNTAPLQPEQLQVFETLEEITGYLYISAWPDSLS
DLSVFQNLQVIRGRILHNGAYSLTLQGLGISWLGLRSLRELGSGLALIHHNNRLCFVHTV
PWDQLFRNPHQALLHTANRPEDECVGEGLACHQLCARGHCWGPGPTQCVNCSQFLRGQEC
VEECRVLQGLPREYVNARHCLPCHPECQPQNGSVTCFGPEADQCVSCAHYKDPPFCVARC
PSGVKPDLSYMPIWKFPDEEGTCQPCPINCTHSCVDLDDKGCPAEQRASPLTSIISAVVG
ILLVVVLGAVFGILIKRRQQKIRKYTMRRLLQETELVEPLTPSGAMPNQAQMRILKETEL
RKVKVLGSGAFGTVYKGIWIPDGENVKIPVAIKVLRENTSPKANKEILDEAYVMAGVGSP
YVSRLLGICLTSTVQLVTQLMPYGCLLDHVRENRGRLGSQDLLNWCMQIAKGMSYLEDVR
LVHRDLAARNVLVKSPNHVKITDFGLARLLDIDETEYHADGGKVPIKWMALESILRRRFT
HQSDVWSYGVTVWELMTFGAKPYDGIPAREIPDLLEKGERLPQPPICTIDVYMIMVKCWM
IDSECRPRFRELVSEFSRMARDPQRFVVIQNEDLGPASPLDSTFYRSLLEDDDMGDLVDA
EEYLVPQQGFFCPDPAPGAGGMVHHRHRSSSTRSGGGDLTLGLEPSEEEAPRSPLAPSEG
AGSDVFDGDLGMGAAKGLQSLPAHDPSPLQRYSEDPTVPLPSETDGYVTPLTCSLQPEYV
NQPDVRPQPPSPREGPLPPARPAGATLERPKTLSPGKNGVVKDVFAFGGAVENPEYLAPR
GGAAPQPHPPPAFSPAFDNLYYWDQDPSERGAPPSTFKGTPTAENPEYLGLDVPV
Download sequence
Identical sequences ENSNLEP00000001285 ENSNLEP00000001285

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]