SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000001296 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000001296
Domain Number 1 Region: 229-287
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000167
Family Complement control module/SCR domain 0.0025
Further Details:      
 
Domain Number 2 Region: 82-143
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000195
Family Complement control module/SCR domain 0.0025
Further Details:      
 
Domain Number 3 Region: 45-97
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000778
Family Complement control module/SCR domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000001296   Gene: ENSNLEG00000001074   Transcript: ENSNLET00000001372
Sequence length 432
Comment pep:known_by_projection supercontig:Nleu1.0:GL397333.1:2183232:2212638:-1 gene:ENSNLEG00000001074 transcript:ENSNLET00000001372 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GSGDSPLEDDEVGYSHPRYKDTPWCSPIKVKYGDVYCRAPQGGYYKTALGARCDIRCQKG
YELHGSSLLICQSNKRWSDKVICKQKRCPTLAMPANGGFKCVDGAYFNSRCEYYCSPGYT
LKGERTVTCMDNKAWSGRPASCVDMEPPRIKCPSVKERIAEPNKLTVRVSWETPEGRDTA
DGILTDVILKGLPPGSNFPEGDHKIQYTVYDRAENKGTCKFRVKVRVKRCGKLNAPENGY
MKCSSDGDNYGATCEFSCIGGYELQGSPARVCQSNLAWSGTEPTCAAMNVNVGVRTAAAL
LDQFYEKRRLLIVSTPTARNLLYRLQLGMLQQAQCGLDLRHITVVELVGVFPTLIGRIGA
KIMPPALALQLRLLLQIPLYSFSMVLVDKHGMDKERYVSLVMPVALFNLIDTFPLRKEEM
VLQAEMGQTCNT
Download sequence
Identical sequences ENSNLEP00000001296

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]