SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000001310 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000001310
Domain Number 1 Region: 222-329
Classification Level Classification E-value
Superfamily TPR-like 2.74e-26
Family Tetratricopeptide repeat (TPR) 0.00067
Further Details:      
 
Domain Number 2 Region: 1940-1989
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000801
Family RING finger domain, C3HC4 0.019
Further Details:      
 
Domain Number 3 Region: 481-595
Classification Level Classification E-value
Superfamily TPR-like 0.00000346
Family Tetratricopeptide repeat (TPR) 0.048
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000001310
Domain Number - Region: 813-887
Classification Level Classification E-value
Superfamily DEATH domain 0.0251
Family Caspase recruitment domain, CARD 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000001310   Gene: ENSNLEG00000001117   Transcript: ENSNLET00000001386
Sequence length 1995
Comment pep:novel supercontig:Nleu1.0:GL397321.1:1913401:1921618:-1 gene:ENSNLEG00000001117 transcript:ENSNLET00000001386 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADYALLEDCPYVDDCVFAAEFMTDDYVRVTQLYCDGVGMQYKDYVQSERNLEFDICSIW
CSKPISVLQDYCDAIKINIFWPLLFQHQNSSVISRLHPCVDANNSRASEINLKRLQHLEL
MEDIVDLAKKVANDSLLIGGLLRIGYKIENKILAMEEALNWIKYAGDVTILTKLGSIDNC
WPMLSIFFTEYKYHITKIVMEDCNLLEELKTQSCMDCIEQGELMKMKGNEEFSKERFDIA
IIYYTRAIEYRPENHLLYGNRALCFLRTGQFRNALGDGKRATILKNTWPKGHYRYCDALS
MLGEYNWALQANITAQKLCKNDPEGIKDLIQQHVNLQKQIEDLQGQTANKNPIKAFYENR
AYTPRSLSAPVFSTSLNFVETERDFRKINHEMANGGNQNLKVMDDALKIDDYDCHPEFSP
PTSQPPKHKGKQKSRNNESEKFSSSSQLTLPADLKNILEKQFSKSSRAAHQDFANIMTML
RSLIQDGYTALLEQRCRSAAHAFTELLNGLDPQKIKQLNLAMINYVLVVYGLAISLLGIG
QPEELSEAENQFKRIIEHYHNEGLDCLAYCGIGKVYLKKNRFLEALNHFEKARTLIYRLP
GVLTWPTSNVIIEESQPEKIKMLLEKFVEECKFPPVPDAICCYQKCCGYSKIQIYITDPD
FKGFIRISCCQYCKIEFHMNCWKKLKTTTFNDKIDKDFLQGICLTPDCEGVISKIIIFSS
GGQVKCEFEHKVIKEKVPPRPILKQKCSSLEKLRLKEDKKLKRKIQKKEAKKLAQERMEE
DLRESNPPKNEEQKETVDNVLHCQFLDDRILQCIKQYADKIKSGIWNTATLLKELLSWKV
LSTEDYTTCFSSRNFLNEAVDYVICHLIQEKNRVKTRIFLHVLSELKEVEPKLAAWIQKL
NSFGLDATGPFFSRYEASLKQLDFSIMTFLWNEKYGHKLDSIEGKQLDYFFEPTSLKEAR
CLIWLLEEHRDKFPALHSALDEFFDIMDSRCTVLRKQDSGEAPFSSTKVKNKGKKKKPKD
SKPMLVGSGTTSVTPNNEIIISSEDHSNQNSDTAGPFAVPDHLRQDVEEFEALYDQHSNE
YVVRNKKLWDMNPKQKCSTLYDYFSQLLEEHGPLDMSHKMFSEEYEFFPEETRPILEKAG
GLKSFLLGCPRFVVIDNCIALKKVASRLKKKRKKKNIKTKVEDISKAGEYLQVKLPLNSA
AREFKPDVKSKPVSGSSSAPGSEDVKSKPVSANSPKPACEDVKAKPVSDNSSRQVSEDGK
PKGVSSNSPKPGTEDANYKRVSSNSPKPVLEDVKPTYWAQSHLVTGYCTYLPFQRFDNTR
TPPAYINVLPGLPQYTSIYTPLASLSPEYQLPRSVPVVPTFVANDRADKNAIAYFEGHHL
NAENAAGHQIASETQILEDSLVISVKSQCSTGDAHTVLSESNRKDGHCGNSNNKCEVIPE
STSAVTNIPQVQMVAIQVSWNITHQEVNTEPYNPFEKQQGEISRIEKEYQVLQDQLKEAY
ENYEQIKLKGLEETRDLEEKLKRHLEENKISKTELGWFLQDLEREIKKWQQEKKEIQETL
KSLKKKIKKVSNANEMYTQKNDGKDKEHELHLDQSLEISNTLTNEKMKIEECIKKGKEDY
EESHQRAVAAEVSVLENWKESEVYKLQIMESQAEAYLKKLELISHDPAAYPDMESDICSW
ELFLSNVTKEIEKAKSQFEEQIKAIKNGSRLSELSKVQISELSFPACNKVHPELLPESSG
HDDQGLKTSASDVTGNHAALHRDPSVFSAGDSPGEAPSVLLPGPPPSQPEATQLPGPKGA
GQAALSEQSPVADQKQPVPPGCAACSSQSPKKPFNSIIEHLSVVFPCYNSTELAGFIKKV
RSKNKNSLSGLSIDEIVQRVTEHILDEQKKKKPNPGKDKRTYEPSSAAPVTRSSQGPPLA
VVAPSPKTKGQKAEDVPVRVAPGTSSCEICHEVFKSKNMRVLKCGHKYHKGCFKQWLKGQ
STCPACQSHDLLSEE
Download sequence
Identical sequences ENSNLEP00000001310

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]