SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000001345 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000001345
Domain Number 1 Region: 525-594
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 8.48e-19
Family Complement control module/SCR domain 0.00033
Further Details:      
 
Domain Number 2 Region: 910-974
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.08e-16
Family Complement control module/SCR domain 0.00069
Further Details:      
 
Domain Number 3 Region: 274-343
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.5e-16
Family Complement control module/SCR domain 0.00057
Further Details:      
 
Domain Number 4 Region: 776-838
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.78e-16
Family Complement control module/SCR domain 0.00047
Further Details:      
 
Domain Number 5 Region: 153-224
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 8.76e-16
Family Complement control module/SCR domain 0.00069
Further Details:      
 
Domain Number 6 Region: 409-472
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000167
Family Complement control module/SCR domain 0.00098
Further Details:      
 
Domain Number 7 Region: 661-723
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000292
Family Complement control module/SCR domain 0.0006
Further Details:      
 
Domain Number 8 Region: 349-419
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000431
Family Complement control module/SCR domain 0.00089
Further Details:      
 
Domain Number 9 Region: 600-670
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000723
Family Complement control module/SCR domain 0.00087
Further Details:      
 
Domain Number 10 Region: 21-83
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000181
Family Complement control module/SCR domain 0.0000264
Further Details:      
 
Domain Number 11 Region: 964-1028
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000625
Family Complement control module/SCR domain 0.0024
Further Details:      
 
Domain Number 12 Region: 88-149
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000903
Family Complement control module/SCR domain 0.0000159
Further Details:      
 
Domain Number 13 Region: 845-904
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000195
Family Complement control module/SCR domain 0.00086
Further Details:      
 
Domain Number 14 Region: 214-285
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000459
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 15 Region: 740-787
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000139
Family Complement control module/SCR domain 0.0044
Further Details:      
 
Domain Number 16 Region: 490-536
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000135
Family Complement control module/SCR domain 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000001345   Gene: ENSNLEG00000001078   Transcript: ENSNLET00000001423
Sequence length 1092
Comment pep:known_by_projection supercontig:Nleu1.0:GL397352.1:1333218:1369207:1 gene:ENSNLEG00000001078 transcript:ENSNLET00000001423 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAAGLLGVFLALVAPGVLGISCGSPPPILNGRISHYSTPIAVGTVIRYICSAGFRLIGE
KSVLCISKDKVDGTWDKPAPKCEYFNKYSSCPEPIVPGGYKIRGSTPYRHGDSVTFACKT
NFSMNGNKSVWCQANNMWGPTRLPTCESVFPLKCPALPMIHNGHHTSENVSSIAPGLSVT
YSCESGYLLVGEKIINCLSSGKWSAVPPTCEEARCKPLGRFPNGKVKEPPILRVGVTANF
FCDEGYRLQGPSSSRCVIAGQGVAWTKMPVCEEIFCPSPPPILNGRHTGNSLANVSYGNI
VTYTCDPDPEEGVNFILIGESTLRCTVDSQKTGTWSGPAPRCELSTPAVQCPHPHILRGR
MVSGQKDRYTYNNTVIFACMFGFTMKGSKQIRCNAQGTWAPSAPVCEKECQAPPNILNGQ
KEDRHMVRFDPGTSIKYSCNPGYVLVGEESIQCTSEGVWTTPVPRCKVAECETTEKQLLT
KPQHQFVRPDVNSSCGEGYKLSGSVYQECQGTIPWFMEIRLCKEITCPPPPVIYNGTHTG
SSLEDFPYGTTVTYTCNPGPERGVEFSLIGESTIRCTSNDQERGTWSGLAPLCKLSLLPV
QCSHVHIANGRKISGKEGPYFYNDTVTFECYDGFTLKGSSQIRCKADNTWDPEIPVCEKG
CQPPPGLHHGHHTGGNTVFFVSGMTVDYTCDPGYLLVGNKSIHCMPSGNWSPSAPRCEET
CQPVREDLQELPVGSRVELVNTSCQDGYQLTGHAYQTCQDAENGIWFKKIPLCKVIRCHP
PPVIANGKHTGMMAENFLYGNEVSYECDQGFYLLGEKKLQCRSDSKGHGSWSGPSPQCLR
SPPVTRCPNPEVKHGYKLNKTHSAYSHNDIVYVDCNPGFIMNGSRVIRCHTDNTWVPGVP
TCIKKAFIGCQPPPKTPNGNHTGGNIARFSPGMSILYSCDQGYLLVGEALLLCTHDGTWS
QPPPHCKEVNCSSPADMDGIQKGLEPRKMYQYGAVVTLECEDGYVLEGSPQSQCQSDHQW
NPPLAVCRSRSLAPVLCGITAGLILLAFLIVVTLYMVSKHRERNYYTNTSQKEAFHLEAR
EVYSVDPYNPAS
Download sequence
Identical sequences G1QKA0
ENSNLEP00000001345 XP_003273037.1.23891 ENSNLEP00000001345

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]