SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000001350 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000001350
Domain Number 1 Region: 24-101
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000118
Family Growth factor receptor domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000001350   Gene: ENSNLEG00000001154   Transcript: ENSNLET00000001428
Sequence length 184
Comment pep:known_by_projection supercontig:Nleu1.0:GL397303.1:88188:95987:-1 gene:ENSNLEG00000001154 transcript:ENSNLET00000001428 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKSVLLLTTLLVPAHLVAAWSNNYAVDCPQHCDSSECKSSPRCKRTVLDDCGCCRVCAAG
RGETCYRTVSGMDGMKCGPGLRCQPSNGEDPFGEEFGICKDCPYGTFGMDCRETCNCQSG
ICDRGTGKCLKFPFFQYSVTKSSNRFVSLTERDMASGDGNVVREEVVKDNAAGSPVMRKW
LNPR
Download sequence
Identical sequences G1QKA5
ENSNLEP00000001350 ENSNLEP00000001350

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]