SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000001352 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000001352
Domain Number 1 Region: 92-164
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.97e-18
Family Complement control module/SCR domain 0.00014
Further Details:      
 
Domain Number 2 Region: 153-221
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 9.57e-18
Family Complement control module/SCR domain 0.0000114
Further Details:      
 
Domain Number 3 Region: 409-481
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.95e-17
Family Complement control module/SCR domain 0.0000232
Further Details:      
 
Domain Number 4 Region: 470-539
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 6.39e-16
Family Complement control module/SCR domain 0.00079
Further Details:      
 
Domain Number 5 Region: 285-349
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000433
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 6 Region: 228-290
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000577
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 7 Region: 352-419
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000334
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 8 Region: 32-97
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000931
Family Complement control module/SCR domain 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000001352   Gene: ENSNLEG00000001155   Transcript: ENSNLET00000001430
Sequence length 552
Comment pep:novel supercontig:Nleu1.0:GL397352.1:1384368:1497636:1 gene:ENSNLEG00000001155 transcript:ENSNLET00000001430 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PPVRSEAAFDSHRSRNPIVNSLMLLWSSPGQCNAPEWLPFAKPTKLIDESEFPTGTYLNY
ECRPGYYGRPFSIICQNNSVWTSAKHRCTRKSCPNPSDPVNGMVDVIKDIQFGSQIKYSC
TKGYRLIGSSSATCILSGNTLIWDNETPVCDRIPCGLPPTIANGDFISTNREYFHYGSVV
TYHCNLGSRGRKVFELVGEPSIYCTSEDDEVGIWSGPAPQCIIPNKCMPPIVENGILVSD
NRSLFSLNEVVEFRCQPGFVMKGPRRVQCQALNKWEPELPSCSRVCQPPPGVLHGERTQR
DKDNFSPGQEVFYSCEPGYDLRGAASLRCTLQGDWSPEAPRCEVKSCDEFMGQLLNGRVL
FPVNLQLGAKVDFVCDEGFQLKGNSASYCVLAGMESLWNSSVPVCERKSCKTPPDPVNGM
VHVITNIQVGSRINYSCTTGHRLIGHSSAECILSGNTAHWSTKPPICQHIFCPNPPAILN
GRHTGTPLGDIPYGKEVSYTCDPHPDRGMTFNLIGESTIRCTSDPHGNGVWSSPAPRCEL
SVRAGAHDALIV
Download sequence
Identical sequences ENSNLEP00000001352

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]