SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000001363 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000001363
Domain Number 1 Region: 50-183
Classification Level Classification E-value
Superfamily C-type lectin-like 2.45e-45
Family C-type lectin domain 0.000000106
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000001363   Gene: ENSNLEG00000001167   Transcript: ENSNLET00000001442
Sequence length 213
Comment pep:known_by_projection supercontig:Nleu1.0:GL397524.1:350168:352255:-1 gene:ENSNLEG00000001167 transcript:ENSNLET00000001442 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPSVRPWGGSAFSQDPRSGPRGAPPPSLSRVPKAPPLAPPLSLSSTPGFVCNTCPEKWI
NFQRKCYYFGKGTKQWVHARYACEDMEGQLVSIHSLEEQDFLTKHASHTGSWIGLRNLDL
KGEFVWVDGSHVDYSNWAPGEPTSRSQGEDCVMMRGSGHWNDAFCDRELGAWVCDRLATC
TPPASEGSAESVGPDSRRGPDGRLPAPSAPLHS
Download sequence
Identical sequences ENSNLEP00000001363

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]