SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000001372 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000001372
Domain Number 1 Region: 21-137
Classification Level Classification E-value
Superfamily Immunoglobulin 1.86e-17
Family V set domains (antibody variable domain-like) 0.00000144
Further Details:      
 
Domain Number 2 Region: 141-232
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000255
Family I set domains 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000001372   Gene: ENSNLEG00000001172   Transcript: ENSNLET00000001451
Sequence length 359
Comment pep:novel supercontig:Nleu1.0:GL397453.1:49557:73049:-1 gene:ENSNLEG00000001172 transcript:ENSNLET00000001451 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALLLRFVLLCGVADFTRSLSITTPEQMIEKAKGETAYGPCKFTLSPEDQGPLDIEWLIS
PADNQKVDQVIILYSGDKIYDDYYPDLKGRVHFKSNDLKSGDVSINVTNLQLSDIGTDQC
KVKKAPGVANKKNQLVVLGEPLGTRCYVDGSEEIGSDFKLKCEPKEGSLPLQYEWQKLSD
SQKMPTSWLAEMTSSVISVKNASSEYSVTYSCTVRNRVGSDQCLLRVDVVPPSNKAGLIA
GAIIGTLLALVLIGLVIFCCRKKRRKEKYEKEVHHDIREDVPPPKSRTSTARSYIGSNHS
SLGSMPPSNMEGYSKTQYNQVPSEDFEPTPQSPTVPPAKVAAPNLSRMGAVPVMIPAQS
Download sequence
Identical sequences ENSNLEP00000001372 ENSNLEP00000001372

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]