SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000001373 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000001373
Domain Number 1 Region: 42-149
Classification Level Classification E-value
Superfamily Fibronectin type III 5.77e-29
Family Fibronectin type III 0.00000442
Further Details:      
 
Domain Number 2 Region: 137-231
Classification Level Classification E-value
Superfamily Fibronectin type III 8.24e-17
Family Fibronectin type III 0.000000783
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000001373   Gene: ENSNLEG00000001139   Transcript: ENSNLET00000001452
Sequence length 354
Comment pep:known_by_projection supercontig:Nleu1.0:GL397348.1:8529475:8535041:-1 gene:ENSNLEG00000001139 transcript:ENSNLET00000001452 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPLLGVGLNTTILTPSGNEDTTADFFLTSMPTDSLSVSTLPLPEVQCFVFNVEYMNCTWN
SSSEPQPTNLTLHYWYKNSDNDKVQKCSHYLFSEEITSGCQLQKKEIHLYQTFVVQLQDP
REPRRQATQMLKLQNLVIPWAPENLTLHKLSESQLELNWNNRFLNHCLEHLVQYRTDWDH
SWTEQSVDYRHKFSLPSVDGQKRYTFRVRSRFNPLCGSAQHWSEWSHPIHWGSNTSKENP
FLFALEAVVISVGSMGLIISLLCVYFWLERTMPRIPTLKNLEDLVTEYHGNFSAWSGVSK
GLAESLQPDYSERLCLVSEIPPKGGALGEGPGASACNQHSPYWAPPCYTLKPET
Download sequence
Identical sequences ENSNLEP00000001373

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]