SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000001388 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000001388
Domain Number 1 Region: 206-360
Classification Level Classification E-value
Superfamily C-type lectin-like 9.62e-51
Family C-type lectin domain 0.000000172
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000001388
Domain Number - Region: 95-159
Classification Level Classification E-value
Superfamily occludin/ELL-like 0.000366
Family Occludin/ELL domain 0.005
Further Details:      
 
Domain Number - Region: 144-206
Classification Level Classification E-value
Superfamily occludin/ELL-like 0.00235
Family Occludin/ELL domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000001388   Gene: ENSNLEG00000001171   Transcript: ENSNLET00000001467
Sequence length 381
Comment pep:known_by_projection supercontig:Nleu1.0:GL397524.1:388077:392411:-1 gene:ENSNLEG00000001171 transcript:ENSNLET00000001467 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDSKEPSVQQLGLLEEEQLRGPGFRQTRGYKSLAGCLGHGALVLQLLSFTLLAGLLIQV
SKFPSSISQEQSKQDAIYQNLTQLKAAVGELSEKSKLQEIYQELTQLKAAVGELPEKSKQ
QEIYQELTRLKAAVGELPEKSKQQEIYQELTRLKAAVGELPEKSKQQEIYQELTQLKAAV
GELPEKSQQQEIYQELTRLKAAVGEFLEPGLLGPEMVIVPDQPPPTERLCRPCPWEWTFF
QGNCYFMSNSQRDWHDSITACQEVGAQLVVIKSAEEQNFLQLQSSRSNRFAWMGLSDLNQ
EGTWQWVDGSPLSPSFKQYWNRGEPNNIGEEDCAEFSGNGWNDDKCNLAKFWICKKSAAS
CSRDEEQFLSPAPATRNPPPA
Download sequence
Identical sequences ENSNLEP00000001388 ENSNLEP00000001388

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]