SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000001422 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000001422
Domain Number 1 Region: 258-394
Classification Level Classification E-value
Superfamily C-type lectin-like 2.62e-48
Family C-type lectin domain 0.000000165
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000001422
Domain Number - Region: 154-191
Classification Level Classification E-value
Superfamily occludin/ELL-like 0.0235
Family Occludin/ELL domain 0.015
Further Details:      
 
Domain Number - Region: 123-253
Classification Level Classification E-value
Superfamily A middle domain of Talin 1 0.0445
Family A middle domain of Talin 1 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000001422   Gene: ENSNLEG00000001186   Transcript: ENSNLET00000001501
Sequence length 398
Comment pep:known_by_projection supercontig:Nleu1.0:GL397524.1:407715:413463:1 gene:ENSNLEG00000001186 transcript:ENSNLET00000001501 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDSKEPRVQPLGLLEEDPTTSGIRLFPRDFQFQQTHGHKSSTGCLGHGPLVLQLLSFTL
LAGVLVAILVQVYKVPSSLSQEQSEQDVIYQNLTQLKAAVGELSEKSKLQEIYQELTQLK
AAVGELPEKSKLQEIYQELTWLKAAVGELPEKSQLQEIYQELTRLKAAVGELPEKSRLQE
IYQELTRLKAAVGELPEKSKLQEIYQELTQLKAAVGELPDQSKQQQIYQELTDLKTAFGE
FLHIEGPRADEPSPDQPLPTERLCCRCPKDWTFFQGNCYFMSNSQRNWHDSVTACQEVGA
QLVVIKSAEEQNFLQLQTYRSNRFSWMGLSDLNQEGTWQWVDGSPLSSSFQRYWNSGEPN
NSGDEDCAEFSGSGWNDNRCNIDNYWICKKPTACFRDE
Download sequence
Identical sequences ENSNLEP00000001422 ENSNLEP00000001422

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]