SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000001445 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000001445
Domain Number 1 Region: 38-173
Classification Level Classification E-value
Superfamily C-type lectin-like 4.72e-37
Family C-type lectin domain 0.000000217
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000001445   Gene: ENSNLEG00000001205   Transcript: ENSNLET00000001524
Sequence length 175
Comment pep:known_by_projection supercontig:Nleu1.0:GL397319.1:6584419:6586841:1 gene:ENSNLEG00000001205 transcript:ENSNLET00000001524 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPPMALPSMSWMLLPCLILLSQVQGEEPQKELPSPRIRCPKGSKAYGSHCYALFLSPKS
WMDADLACQKRPSGNLVSVLSGAEGSFVSSLVRSISNSYSYIWIGLHDPTQGSEPDGNGW
EWSSTDVMNYFAWEKNPSTILNPGHCRSLSRSTGFLKWKDYNCDAKLPYVCKFND
Download sequence
Identical sequences G1QKK0
ENSNLEP00000001445 ENSNLEP00000001445 XP_003268775.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]