SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000001450 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000001450
Domain Number 1 Region: 9-55
Classification Level Classification E-value
Superfamily C-type lectin-like 0.0000944
Family C-type lectin domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000001450   Gene: ENSNLEG00000001221   Transcript: ENSNLET00000001530
Sequence length 56
Comment pep:novel supercontig:Nleu1.0:GL397319.1:6594677:6595463:-1 gene:ENSNLEG00000001221 transcript:ENSNLET00000001530 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLLSMARTNSCFMLISCLMCLSLSQGQEGQAELPKSRISCPEDANAYGSYCYYFFL
Download sequence
Identical sequences ENSNLEP00000001450 ENSNLEP00000001450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]