SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000001462 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSNLEP00000001462
Domain Number - Region: 51-115
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000511
Family I set domains 0.025
Further Details:      
 
Domain Number - Region: 275-315
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0093
Family TNF receptor-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000001462   Gene: ENSNLEG00000001223   Transcript: ENSNLET00000001543
Sequence length 338
Comment pep:known_by_projection supercontig:Nleu1.0:GL397430.1:1710818:1720702:1 gene:ENSNLEG00000001223 transcript:ENSNLET00000001543 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMRTWVLLFAVLWCLTGVRCPRSTLFNAKGFIYGKTGQPDKIYVKLHQNSPVLTCMDFKL
SKKEIVDPTYLWIGPNEKTLTGNNRINITKTGQLMVKDFLEPLSGLYTCTLSYKTVKAET
QEEKTVKKRYDFMVFAYREPDYSYRMAVRFTTKSCIGRYNDVFFRVLKKILDNLMSDLSC
HVIEPSYKCHSVEIPEHGLIRELFIAFQVNPSAPGWKGACNGPADCEDTTNHNILQARDR
IEEFFRSQAYIFYHNLNKTLPAVHFVDHSLQVVRLDSCQPGFGKNESLHSNCASCCVVCS
PATFSPDVNVTCQTCVSVLTYGAKSCPQTSNENQQYED
Download sequence
Identical sequences G1QKL7
ENSNLEP00000001462 ENSNLEP00000001462 XP_003278292.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]