SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000001487 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000001487
Domain Number 1 Region: 289-410
Classification Level Classification E-value
Superfamily EF-hand 6.11e-33
Family Osteonectin 0.0093
Further Details:      
 
Domain Number 2 Region: 198-270
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 1.02e-20
Family Thyroglobulin type-1 domain 0.0014
Further Details:      
 
Domain Number 3 Region: 17-63
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000374
Family Ovomucoid domain III-like 0.0034
Further Details:      
 
Domain Number 4 Region: 52-108
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 0.00000000746
Family Thyroglobulin type-1 domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000001487   Gene: ENSNLEG00000001262   Transcript: ENSNLET00000001571
Sequence length 433
Comment pep:known_by_projection supercontig:Nleu1.0:GL397511.1:364400:513907:1 gene:ENSNLEG00000001262 transcript:ENSNLET00000001571 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FFSFKFLRVDQDKDKDCSLDCAGSPQKPLCASDGRTFLSRCEFQRAKCKDPQLEIAYRGN
CKDVSRCVAERKYTQEQARKEFQQVFIPECNDDGTYSQVQCHSYTGYCXXXXXXXXXXXX
FHFTPYFPLLGSVNEKLPQREGTGKTVSLQIFSVLNSDDAAAPALETQPQGDEEDIASRY
PTLWTEQVKSRQNKTNKNSVSSCDQEHQSALEEAKQPKNDNVVIPECAHGGLYKPVQCHP
STGYCWCVLVDTGRPIPGTSTRYEQPKCDNTARAHPAKARDLYKGRQLQGCPGAKKHEFL
TSVLDALSTDMVHAVSDPSSSSGRLSEPDPSHTLEERVVHWYFKLLDKNSSGDIGKKEIK
PFKRFLRKKSKPKKCVKKFVEYCDVNNDKSISVQELMGCLGVAKEDGKADTKKRHTPRGN
AESTSNRQPRKQG
Download sequence
Identical sequences ENSNLEP00000001487 ENSNLEP00000001487

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]