SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000001513 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000001513
Domain Number 1 Region: 6-111
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 5.23e-33
Family Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 0.0000164
Further Details:      
 
Domain Number 2 Region: 205-334
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain 1.83e-24
Family Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain 0.0012
Further Details:      
 
Domain Number 3 Region: 110-179
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.000000259
Family Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000001513   Gene: ENSNLEG00000001292   Transcript: ENSNLET00000001600
Sequence length 341
Comment pep:novel supercontig:Nleu1.0:GL398241.1:7115:21544:-1 gene:ENSNLEG00000001292 transcript:ENSNLET00000001600 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AGTRGAGCLITEGCRGEGGILINSQGERFMERYAPVAKDLASRDVVSRSMTLEIREGRGC
GPEEDHVYLQLHHLPPEQLATRLRGISETAVIFIGVDVMKEPIPVLPTVHYNMDGIPTSY
KGQVLRHVNGQDQIVPGLYTCGEAACASVHGANRLGANSLLDLVVGQACALSIEKSCRPG
DKVPPIKPNAGEESVMNLDKLRFADGSIRTSELRLSMQKSVQNRAAVFRVGSVLQEGCGK
IKLCRDLKDLKTFTPGMVWNTDLVETLELQNLMLCAPQTISGAEAWKESRGAQAREDCKV
WINECDHSKPIQGKQKKPFEKHWRKHTLSYLDVSTGKVSVE
Download sequence
Identical sequences ENSNLEP00000001513 ENSNLEP00000001513

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]