SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000001516 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000001516
Domain Number 1 Region: 32-130
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000434
Family V set domains (antibody variable domain-like) 0.044
Further Details:      
 
Domain Number 2 Region: 131-208
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000447
Family I set domains 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000001516   Gene: ENSNLEG00000001267   Transcript: ENSNLET00000001603
Sequence length 243
Comment pep:known_by_projection contig::ADFV01135143.1:12491:37727:1 gene:ENSNLEG00000001267 transcript:ENSNLET00000001603 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCSRGWDSCLALELLLLPVSLLATSIQGHFVHMTMVSGSNVTLNISESLPENYKQLTWFY
TFDQKIVEWDSRKSKYFESRFKGRVRLDPQSGALYISNVQKEDNSIYIMRVLKKTGNEQE
WKIKLQVLDPVPKPVINIEKIEDVDNNCYLKLSCVIPGESVNYTWYGDKRPFPNEFQNSV
LETTLKPHNYSRCYTCQVSNSVSRKNGTVCLSPPCTLARSFGVEWIASWLVVTVPTILGL
FLT
Download sequence
Identical sequences H9H9W6
ENSNLEP00000001516 XP_003282310.1.23891 ENSNLEP00000001516

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]