SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000001568 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000001568
Domain Number 1 Region: 176-254
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000844
Family I set domains 0.031
Further Details:      
 
Domain Number 2 Region: 6-78
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000256
Family I set domains 0.0033
Further Details:      
 
Domain Number 3 Region: 100-177
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000341
Family I set domains 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000001568   Gene: ENSNLEG00000001339   Transcript: ENSNLET00000001657
Sequence length 261
Comment pep:novel supercontig:Nleu1.0:GL397798.1:87506:93087:-1 gene:ENSNLEG00000001339 transcript:ENSNLET00000001657 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAMEVVILTCDPETPDASYLWWMNGQSLPVTHRLQLSRSNRTLFIFGVTKYIAGPYECE
IRNPVSASRSDPVTLNLLPKLPRPYITINNLHPRENMDVLAFTCEPKSENYTYRWWLNGQ
SLPISPSVKRPIENRILILPRVTRNETGPYQCEIRDRYGGIRSNPVTVNVLYGPDLPRIY
PSFTYYRSGENLYLSCFVDSNPPAQYSWTINGKFQLSGQKLSIRQITTKHSGLYACSVRN
SATGKESSRSITVNVSDWTLP
Download sequence
Identical sequences XP_003282335.3.23891 ENSNLEP00000001568

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]