SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Home > Genomes > Nomascus leucogenys 76_1.0 > ENSNLEP00000001568

Domain assignment for ENSNLEP00000001568 from Nomascus leucogenys 76_1.0

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:	ENSNLEP00000001568
Domain Number 1	Region: 176-254
Classification Level	Classification	E-value
Superfamily	Immunoglobulin	0.00000000000000844
Family	I set domains	0.031
Further Details:

Domain Number 2	Region: 6-78
Classification Level	Classification	E-value
Superfamily	Immunoglobulin	0.00000000000256
Family	I set domains	0.0033
Further Details:

Domain Number 3	Region: 100-177
Classification Level	Classification	E-value
Superfamily	Immunoglobulin	0.00000000000341
Family	I set domains	0.014
Further Details:

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function
Biological Process
Cellular Component

Cellular Component	IC (bits)	H-Score

Molecular Function	IC (bits)	H-Score

Biological Process	IC (bits)	H-Score

Protein sequence

External link(s)	Protein: ENSNLEP00000001568 Gene: ENSNLEG00000001339 Transcript: ENSNLET00000001657
Sequence length	261
Comment	pep:novel supercontig:Nleu1.0:GL397798.1:87506:93087:-1 gene:ENSNLEG00000001339 transcript:ENSNLET00000001657 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	MEAMEVVILTCDPETPDASYLWWMNGQSLPVTHRLQLSRSNRTLFIFGVTKYIAGPYECE IRNPVSASRSDPVTLNLLPKLPRPYITINNLHPRENMDVLAFTCEPKSENYTYRWWLNGQ SLPISPSVKRPIENRILILPRVTRNETGPYQCEIRDRYGGIRSNPVTVNVLYGPDLPRIY PSFTYYRSGENLYLSCFVDSNPPAQYSWTINGKFQLSGQKLSIRQITTKHSGLYACSVRN SATGKESSRSITVNVSDWTLP
Download sequence
Identical sequences	ENSNLEP00000001568 XP_003282335.3.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]