SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000001576 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000001576
Domain Number 1 Region: 98-171
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.08e-16
Family Complement control module/SCR domain 0.000025
Further Details:      
 
Domain Number 2 Region: 223-287
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 5.84e-16
Family Complement control module/SCR domain 0.00084
Further Details:      
 
Domain Number 3 Region: 155-225
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000625
Family Complement control module/SCR domain 0.00079
Further Details:      
 
Domain Number 4 Region: 35-89
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000459
Family Complement control module/SCR domain 0.0000285
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000001576   Gene: ENSNLEG00000001160   Transcript: ENSNLET00000001665
Sequence length 377
Comment pep:known_by_projection supercontig:Nleu1.0:GL397352.1:1510425:1553921:1 gene:ENSNLEG00000001160 transcript:ENSNLET00000001665 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPRGRRKCPFPSRRFPGLLLAALVLLLSSFSDACEEPPTFEAMELVGKPKPYYEIGERV
DYKGKKGYFYIPPLATHTICDRNHTWLPVSDDACYRETCPYLGDPLNGQAILANGTYEFG
YQIHFICNEGYYLIGKEILYCELKGSVAIWSGKPPICEKVLCTPPPKIKNGKHTFSEVEV
FEYLDAVTYSCDPAPGPDPFALIGESTIYCGDNSVWSHAAPECKVVKCRFPVVKNGKQIS
GFGKKFYYKATVMFECDKGFYLTGSDTIVCDSNSTWDPPVPKCLKVSTSPTTKSPTSSAS
GPRPTYKPPVSNYPGYPKPEEGILDSLDVWVIALIVIAIVVGVAVICVVLYRYLQRRKKK
GTYLTDETHRGVKFTSL
Download sequence
Identical sequences G1QKX1
XP_012362192.1.23891 ENSNLEP00000001576

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]