SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000001593 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000001593
Domain Number 1 Region: 4-134
Classification Level Classification E-value
Superfamily C-type lectin-like 5.25e-25
Family C-type lectin domain 0.0017
Further Details:      
 
Domain Number 2 Region: 689-811
Classification Level Classification E-value
Superfamily PKD domain 1.77e-23
Family PKD domain 0.002
Further Details:      
 
Domain Number 3 Region: 1624-1746
Classification Level Classification E-value
Superfamily PKD domain 1.65e-22
Family PKD domain 0.0022
Further Details:      
 
Domain Number 4 Region: 1283-1403
Classification Level Classification E-value
Superfamily PKD domain 9.42e-22
Family PKD domain 0.0068
Further Details:      
 
Domain Number 5 Region: 1078-1147
Classification Level Classification E-value
Superfamily PKD domain 0.0000000000000955
Family PKD domain 0.0041
Further Details:      
 
Domain Number 6 Region: 1152-1233
Classification Level Classification E-value
Superfamily PKD domain 0.00000000000157
Family PKD domain 0.0077
Further Details:      
 
Domain Number 7 Region: 1417-1487
Classification Level Classification E-value
Superfamily PKD domain 0.00000000000523
Family PKD domain 0.0054
Further Details:      
 
Domain Number 8 Region: 1485-1572
Classification Level Classification E-value
Superfamily PKD domain 0.0000000000562
Family PKD domain 0.0091
Further Details:      
 
Domain Number 9 Region: 912-979
Classification Level Classification E-value
Superfamily PKD domain 0.0000000000589
Family PKD domain 0.0046
Further Details:      
 
Domain Number 10 Region: 822-893
Classification Level Classification E-value
Superfamily PKD domain 0.000000000353
Family PKD domain 0.0068
Further Details:      
 
Domain Number 11 Region: 990-1063
Classification Level Classification E-value
Superfamily PKD domain 0.0000000405
Family PKD domain 0.0056
Further Details:      
 
Domain Number 12 Region: 502-615
Classification Level Classification E-value
Superfamily PKD domain 0.0000157
Family PKD domain 0.0091
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000001593
Domain Number - Region: 414-465
Classification Level Classification E-value
Superfamily Thermostable phytase (3-phytase) 0.0301
Family Thermostable phytase (3-phytase) 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000001593   Gene: ENSNLEG00000001332   Transcript: ENSNLET00000001683
Sequence length 2220
Comment pep:known_by_projection supercontig:Nleu1.0:GL398404.1:21:12277:-1 gene:ENSNLEG00000001332 transcript:ENSNLET00000001683 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VVHPLCPSDTEIFPGNGHCYRLVVEKAAWLQAQEQCRAWAGAALAMVDNPAVQRFLVSRV
TRSLDVWIGFSTVQGAEVGPAPQGEAFSLESCQNWLPGEPHPATAEHCVRLGPTGWCNTD
LCSAPHSYVCELRPGGPVQDAENLLVGAPSGDLQGPLTPLAQQDSLSAPHEPVEVMVFPG
LSLSHEAFLTTAEFGTQELRRPAQLRLQVYRLLSTAGSLENGSEPESRSLDNRAQLAPAC
MPGGRWCPGANVCLPLDASCHPQACANGCTSGPGLPGAPYALWREFLFSVPAGPPAHYSV
TLHGQDVLMLPGDLVGLQHDAGPGALLHCSPAPGHPGPKAPYLSANASSWLPHLPAQLEG
TRACPACALRLLAATEQLTVLLGLRPNPGLRLPGRYEVRAEVGNGVSRHNLSCSFDVVSP
VAGLRVIYPAPRDGRLYVPTNGSALVLQVDSGANATATARWPGGNVSARFEAACPALVAT
FVPGCPWETNNTLFSVVALPWLSEGEHVVDVVAENSASRANLSLRVTVEEPICGLRATPS
PEARVLQGVLVRYSPVVEAGSDMVFRWTINDKQSLTFQNVVFNVIYQSAAVFKLSLTASN
HVSNVTVNYNVTVERMNRMQGLRVSTVPAVLSPNATLALTAGVLVDSAVEVAFLWTFGDG
EQALHQFQPPYDESFLVPDPSVAQVLVEHNVTHIYAAPGEYMLTVLASNAFENLTQQVPV
SVRAALPSVAVGVSDGVLVAGRPVTFYPHPLPSPGGVLYTWDFGDGSPVLTQSQPAANHT
YASRGTYHVRLEVNNTVSGAAAQADVRVFEELRGLSVDMSLSVEQGAPVVISAAVQTGDN
ITWTFDMGDGTVLSGPEATVEHVYLRAQNCTVTVCAASPAGRLSRSLDVLVFVLEVLRIE
PAACIPMQPDARLTAYVTGNPAHYLFDWTFGDGSSNTTVRGCPMVTHNFTQSGTFPLALV
LSSQVNKAHYFTSICVEPEVGNVTLQPERQFVQLGDEARLVACAWPPFTYRYAWDFGTEE
AAPARAGGPEVTFLYRDTGSYLVTVTASNNVSAANDSALVEVQEPVVVTDIKVNGSLVLE
LQQPYLFSAVGCGRPASYLWDLGDGGRFEGPEVTYAYNSTGNFTVRVAGWNEVSRSEAWL
NVTVKRRVRGLVVNASRTVVPLNGSVSFSTSLEAGSDVRYSWVLCDRCTPIPGGPTISYT
FRSVGTFNIIVTAENEVGSAQDSIFVYVLQLIEGLHVVGGGRYFPTNHTVQLQAVLRDGT
NISYSWTAWRDTGPALAGSGKGFSLTAPEAGTYHVQLRATNMLGSAWAECTVEFVEPVGW
LMVAASPNPAAVNTSVTLSAELAGGSGVVYTWSLEEGLSWDTPESFTTHSFPMPGLHLVT
VTAGNPLGSANATVEVDVQVPVSGLSIRASEPGGSFVAAGSSVPFWGQLATGTNVSWCWA
VPGGSSKRGPHVTMVFPDAGTFSIRLNASNAVSWVSATHNLTVEEPIVGLVLWASSKVVA
PGQLVHFQILLAAGSAVTFCLQVGGASPEVLPGPRFSHSFSRVGDHVVSVQGKNHVSWAQ
AQVRIVVLEAVSGLQVPNCCEPGIATGTERNFTARVQRGSRVAYAWYFSLQKVQGDSLVI
LSGRDVTYTPVAAGLLEIQVRAFNALGSENRTLVLEVQDAVQYVALRSGPCFTNRSAQFE
AATSPSPRRVAYHWDFGDGSPGQDTDEPRAEHSYLSPGDYRVQVNASNLVSFFVAQATVT
VQVLACREPEVDVVLPLQVLMRRSQRNYLEAHVDLRDCVTYQTEYRWEVYRTASCQRPGR
PARVALPGVDVSRPQLVLPRLALPVGHYCFVFVVSFGDTPLARSIQANVTVAPERLVPII
EGGSYRVWSDTQDLVLDGSESYDPNLEDGDQTPLGFHWACVASTQREAGGCALNFGPRGS
SVVTIPRERLSAGVEYTFSLTVWKAGRKEEATNQTVLIRSGRVPIVSLECVCKAQAVYEV
SRSSYVYLEGRCLNCSSGSKRGRWAARTFSNKTLVLDETTTSTGSAGMRLVLRRGVLRDG
EGYTFTLTVLGHSGEEEGCASIRLSPNRPPLGGSCRLFPLGAVHALTTKVHFECTGWHDA
EDAGAPLVYALLLRRCRQGHCEEFCVYKGSLSSYGAVLPPGFRPHFEVGLAVVVQDQLGA
AVVALNRSLAITLPEPNGSATGLTVWLHGLTASVLPGLLRQADPQHVIEYSLALVTVLNE
Download sequence
Identical sequences ENSNLEP00000001593 ENSNLEP00000001593

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]