SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000001680 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000001680
Domain Number 1 Region: 63-87
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000000119
Family CCCH zinc finger 0.0046
Further Details:      
 
Domain Number 2 Region: 38-60
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000445
Family CCCH zinc finger 0.005
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000001680
Domain Number - Region: 120-142
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000196
Family CCCH zinc finger 0.0062
Further Details:      
 
Domain Number - Region: 146-172
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00114
Family CCCH zinc finger 0.0044
Further Details:      
 
Domain Number - Region: 92-117
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.089
Family CCCH zinc finger 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000001680   Gene: ENSNLEG00000001420   Transcript: ENSNLET00000001778
Sequence length 179
Comment pep:known_by_projection supercontig:Nleu1.0:GL397467.1:956165:969658:-1 gene:ENSNLEG00000001420 transcript:ENSNLET00000001778 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQEVIAGLERFTFAFEKDVEMQKGTGLLPFQGMDKSASAVCNFFTKGLCEKGKLCPFRHD
RGEKMVVCKHWLRGLCKKGDHCKFLHQYDLTRMPECYFYSKFGDCSNKECPFLHVKPAFK
SQDCPWYDQGFCKDGPLCKYRHVPRIMCLNYLVGFCPEGPKCQFAQKIREFKLLPGSKI
Download sequence
Identical sequences G1QL67
ENSNLEP00000001680 XP_003279670.1.23891 ENSNLEP00000001680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]