SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000001770 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000001770
Domain Number 1 Region: 102-422
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 2.16e-61
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.0000000424
Further Details:      
 
Domain Number 2 Region: 417-554
Classification Level Classification E-value
Superfamily Ricin B-like lectins 1.63e-24
Family Ricin B-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000001770   Gene: ENSNLEG00000001353   Transcript: ENSNLET00000001873
Sequence length 558
Comment pep:known_by_projection supercontig:Nleu1.0:GL397292.1:3621563:3720864:1 gene:ENSNLEG00000001353 transcript:ENSNLET00000001873 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRKIRANAIAILTVAWILGTFYYLWQDNRAHAASSGGRGTQRAGRRPEQLREDRTIPLIV
TGTPSKGFDEKAYLSAKQLKAGEDPYRQHAFNQLESDKLSPDRPIRDTRHYSCPSVSYSS
DLPATSVIITFHNEARSTLLRTVKSVLNRTPANLIQEIILVDDFSSDPEDCLLLTRIPKV
KCLRNDRREGLIRSRVRGADVAAATVLTFLDSHCEVNTEWLPPMLQRVKEDHTRVVSPII
DVISLDNFAYLAASADLRGGFDWSLHFKWEQIPLEQKMTRTDPTRPIRTPVIAGGIFVID
KSWFNHLGKYDAQMDIWGGENFELSFRVWMCGGSLEIVPCSRVGHVFRKRHPYNFPEGNA
LTYIRNTKRTAEVWMDEYKQYYYEARPSAIGKAFGSVATRIEQRKKMNCKSFRWYLENVY
PELTVPVKEALPGIIKQGVNCLESQGQNTAGDFLLGMGICRGSAKNPQPAQAWLFSDHLI
QQQGKCLAATSTLMSSPGSPVILQMCNPREGKQKWRRKGSFIQHSVSGLCLETKPAQLVT
SKCQADAQAQQWQLLPHT
Download sequence
Identical sequences G1QLF5
XP_003263671.1.23891 ENSNLEP00000001770 ENSNLEP00000001770

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]