SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000001814 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000001814
Domain Number 1 Region: 374-504
Classification Level Classification E-value
Superfamily C-type lectin-like 9.27e-34
Family C-type lectin domain 0.00087
Further Details:      
 
Domain Number 2 Region: 1241-1381
Classification Level Classification E-value
Superfamily C-type lectin-like 1.4e-30
Family C-type lectin domain 0.0013
Further Details:      
 
Domain Number 3 Region: 174-359
Classification Level Classification E-value
Superfamily C-type lectin-like 4.2e-30
Family C-type lectin domain 0.00099
Further Details:      
 
Domain Number 4 Region: 807-939
Classification Level Classification E-value
Superfamily C-type lectin-like 5.6e-29
Family C-type lectin domain 0.001
Further Details:      
 
Domain Number 5 Region: 1117-1237
Classification Level Classification E-value
Superfamily C-type lectin-like 3.32e-28
Family C-type lectin domain 0.0021
Further Details:      
 
Domain Number 6 Region: 954-1098
Classification Level Classification E-value
Superfamily C-type lectin-like 3.15e-27
Family C-type lectin domain 0.00059
Further Details:      
 
Domain Number 7 Region: 659-800
Classification Level Classification E-value
Superfamily C-type lectin-like 2.77e-25
Family C-type lectin domain 0.0017
Further Details:      
 
Domain Number 8 Region: 38-162
Classification Level Classification E-value
Superfamily Ricin B-like lectins 1.14e-23
Family Cysteine rich domain 0.01
Further Details:      
 
Domain Number 9 Region: 510-646
Classification Level Classification E-value
Superfamily C-type lectin-like 2.27e-23
Family C-type lectin domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000001814   Gene: ENSNLEG00000001340   Transcript: ENSNLET00000001918
Sequence length 1462
Comment pep:known_by_projection supercontig:Nleu1.0:GL397304.1:5173575:5296686:-1 gene:ENSNLEG00000001340 transcript:ENSNLET00000001918 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLSPSLLLLLLLGAPRGCAEGVAAALTPERLLEWQNKGIFVIQSESLKKCIQAGKSVLT
LENCKQANKHMLWKWVSNHGLFNIGGSGCLGLNFSTPEQPLSLYECDSTLVSLRWRCNRK
MITGPLQYSVQVAPDNTVVASRKYFHKWISYGSGGGDICEYLHKDLHTIKGNTHGMPCMF
PFQYNHQWHHECTREGRGDDLLWCATTSRYERDEKWGFCPDPTSAEVGCDTIWEKDLNSH
ICYQFNLLSSLSWSEAHFSCQMQGGALLSITDETEENFIREHMSSKAVEVWMGLNQLDEH
AGWQWSDGTPLNYLNWSPEVNFEPFVEDHCGTFSSFMPNAWRSRDCESTLPYICKKYLNH
IDHEIVEKDAWKYYATHCEPGWNPYNRNCYKLQKEEKTWHEALRSCQADNSALIDITSLA
EVEFLVILLGDENASETWIGLSSNKIPVSFEWSNNSSVIFTNWHTLEPQIFPNRSQLCVS
AEQSEGHWKVKNCEETLFYICKKAGRVLSDAESGCQEGWERHGGFCYKIDTVLRSFDQAS
SGYYCPPALVTITNRFEQAFITSLISSVVKMKDSYFWIALQDHNDTGEYTWKPAGRKPEP
VQYTHWNAHQPRYSGGCVAMRGRHPLGRWEVKDCRHFKAMSLCKQPVENQEKAEYEERWP
FHPCYLDWESEPGLASCFKVFHSEKVLMKRTWGEAEAFCEEFGAHLASFAHIEEEDFVNE
LLHSKFNWTEERQFWIGFNKRNPLNAGSWEWSDRTPVVSSFLDNNYFGEDARNCAVYKAN
KTLLPLHCGSKREWICKIPRDVKPKIPFWYQYDVPWLFYQDAEYLFHTFASEWLNFEFVC
SWLHSDLLTIHSAHEQEFIHSKIKALSKYGASWWIGLQEERANYEFRWRDGTPVIYQNWD
TGRERTVNNQSQRCGFISSITGLWGSEECSVSMPSICKRKKVWLIEKKKDTPKQQGTCPK
GWLYFNSKCLLLNIPKDPSSWKNWMHAQHFCAEEGGTLVAIESEVEQAFITMNLFGQTTN
VWIGLQNDDYETWLNGKPVVYSNWSPFDIINIPSHNTTEVQKHIPLCALLSSNPNFHFTG
KWYFEDCGKEGYGFVCEKIQDTSGHGVNTSDMYPMPNTLEYGNRTYKIINANVTWYAAIK
TCLMHGAQLVSITDQYHQSFLTVVLNRLGYAHWIGLFTTDNGLNFDWSDGTKSSFTFWKD
EESSLLGDCVFADTNGRWHSTACESFLQGAICHVPPETRQSEHPELCSETSIPWVKFKSN
CYSFSTVLDSMSFEAAHEFCKKEGSNLLTIKDEAENAFLLEELFAFGSSVQMVWLNAQFD
GNNETIKWFDGTPTDQSNWGIRKPDTDYFKPHHCVALRIPEGLWQLSPCQEKKGFICKME
TGFSFKKNLLSGPSHSIIPLAVVLTLIVIVAVCTLSFCIYKHNSGFFRRLAGFRNPYYPA
PNFSTVHLEENILISDLEKSDQ
Download sequence
Identical sequences ENSNLEP00000001814 ENSNLEP00000001814

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]