SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000001818 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000001818
Domain Number 1 Region: 281-483
Classification Level Classification E-value
Superfamily Fibronectin type III 7.9e-40
Family Fibronectin type III 0.00000393
Further Details:      
 
Domain Number 2 Region: 893-1087
Classification Level Classification E-value
Superfamily Fibronectin type III 4.34e-39
Family Fibronectin type III 0.000000749
Further Details:      
 
Domain Number 3 Region: 1414-1610
Classification Level Classification E-value
Superfamily Fibronectin type III 1.72e-33
Family Fibronectin type III 0.0026
Further Details:      
 
Domain Number 4 Region: 684-891
Classification Level Classification E-value
Superfamily Fibronectin type III 4.02e-32
Family Fibronectin type III 0.00000355
Further Details:      
 
Domain Number 5 Region: 487-674
Classification Level Classification E-value
Superfamily Fibronectin type III 1.13e-30
Family Fibronectin type III 0.00000264
Further Details:      
 
Domain Number 6 Region: 1091-1234
Classification Level Classification E-value
Superfamily Fibronectin type III 2.3e-30
Family Fibronectin type III 0.00069
Further Details:      
 
Domain Number 7 Region: 1242-1415
Classification Level Classification E-value
Superfamily Fibronectin type III 1.86e-27
Family Fibronectin type III 0.00098
Further Details:      
 
Domain Number 8 Region: 93-184
Classification Level Classification E-value
Superfamily Immunoglobulin 2.4e-19
Family I set domains 0.012
Further Details:      
 
Domain Number 9 Region: 189-288
Classification Level Classification E-value
Superfamily Immunoglobulin 3.38e-18
Family I set domains 0.026
Further Details:      
 
Domain Number 10 Region: 6-90
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000969
Family I set domains 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000001818   Gene: ENSNLEG00000001443   Transcript: ENSNLET00000001922
Sequence length 1863
Comment pep:known_by_projection supercontig:Nleu1.0:GL397467.1:1058898:1204590:-1 gene:ENSNLEG00000001443 transcript:ENSNLET00000001922 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QFVKEPERHITAEMEKVVDIPCQAKGVPPPSITWYNDAAVVEVEKLARFRHRSDEGLQIS
GLVPDDTGMFQCFARNAAGEVQTSTYLAVTSIAPNITRGPLDSTVIDGMSVVLACETSGA
PRPAITWQKGERILASGSVQLPRFTPLESGSLLISPTHISDAGTYTCLATNSRGVDEASA
DLVVWARTRITKPPQDQSVIKGTQASMVCGVTHDPRVTIRYIWEKDGATLGIESNPRIRL
DRNGSLHISQTWSGDIGTYTCRVISAGGNDSRSAHLRVKQLPHAPEHPVATLSTVERRAI
NLTWTKPFDGNSPLIRYVLEMSENNAPWTVLLASVDPKATSVTVKGLVPARSYQFRLCAV
NDVGKGQFSKDTERVSLPEEPPTAPPQNVIASGRTNQSIMIQWQPPPESHQNGILKGYII
RYCLAGLPVGYQFKNITDADVNNLLLEDLIIWTNYEIEVAAYNSAGLGVYSSKVTEWTLQ
GVPTVLPGNVHTEATNSTTIRFTWNATSPQFINGINQGYKLIAWEPEQEEEVTMVTARPN
FQDSIHVGFVSGLKKFTEYFTSVLCFTTPGDGPRSTPQLVRTHEDVPGPVGYLSFSEILD
TSLKVSWQEPGEKNGILTGYRISWEEYNRTNTRVTHYLPNVTLEYRVTGLTALTTYTIEV
AAMTWKGQGQVSASTISSGVPPELPGPPTNLGISNIGPRSVTLQFRPGYDGKTSISRWLV
EAQVGVVGEGEEWLLIHQLSNEPDARSMEVPDLNPFTYYSFRMHQVNIVGTSPPSQPSRK
IQTLQAPPDMAPANVSLCTASETSLWLRWMPLPEMEYNGNPESVGYKIKYSRSDGHGKTL
SHVVQDRVERGYAIKDLEEWTEYRIQVQAFNASRSWPWSQMVVGRTRESVPSSGPTNVSA
LATTSSSMLVRWSEVPEADRNGLVLGYKVMYKEKDSDAQPFWLGEGNSSRSAQLTGLGKY
VLYEVQVLAFTRIGDGSPSHPPILERTLDDVPGPPMGILFPEVRTTSVRLIWQPPAAPNG
IILAYQITHRLNTTTANTATVEVLAPSARQYTATGLKPESVYLFRITAQTRKGWGEAAEA
LVVTTEKRVRPQPPSRPMVQQEDVRARSVLLSWEPGSDGLSPVRYYTIQTRELPSGRWAL
HSASVSHNTSSFIVDRLKPFTSYKFRVKATNDIGDSEFSEESESLTTLQAAPDEAPTILS
VTPHTTTSVLIRWQPPAEDKINGILLGFRIRYRELLYEGLRGFTIRGINNPGATWAELTP
MYSMRNLSRPSLTQYELDNLNKHRRYEIRMSVYNAVGEGPSSPPQEVFVGEAVPTAAPRN
VVVHGTTATQLDVTSEPPPLDSQNGDIQGYKIYFWEAQRGNLTERVKTLFLAENSVKLKN
LTGYTAYMVSVAAFNAAGDGPRSTPTQGQTQQAAPSAPSSVKFSELTTTSVNVSWEAPQF
PNGILEGYRLVYEPCSPVDGVSKIVTVDVKGNSPLWLKVKDLAEGVTYRFRIRAKTFTYG
PEIEANVTTGPGEGAPGPPGVPIIVRYSSAIAIHWSSGDPGKGPITRYVIEARPSDEGLW
DILIKDIPKEVSSYTFSMDILKPGVSYDFRVIAVNDYGFGTPSSPSQSVPAQKANPFYEE
WWFLVVIALVGLIFILLLVFVLIIRGQSKKYAKKTDSGNSAKSGALGHSEMMSLDESSFP
ALELNNRRLSVKNSFCRKNGLYTRSPPRPSPGSLHYSDEDVTKYNDLIPAESSSLTEKPS
EISDSQGSDSEYEVDSNHQKAHSFVNHYISDPTYYNSWRRQQKGISRAQAYSYTESDSGE
PDHAAVTNSTSTQQGSLFRPKASRTPTPQNPPNPPSQQSTLYRPPSSLAPGSRAPIAGFS
SFV
Download sequence
Identical sequences ENSNLEP00000001818

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]