SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000001861 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000001861
Domain Number 1 Region: 584-861
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.2e-68
Family Protein kinases, catalytic subunit 0.0000017
Further Details:      
 
Domain Number 2 Region: 295-492
Classification Level Classification E-value
Superfamily Fibronectin type III 1.14e-25
Family Fibronectin type III 0.0022
Further Details:      
 
Domain Number 3 Region: 105-207
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000012
Family V set domains (antibody variable domain-like) 0.017
Further Details:      
 
Domain Number 4 Region: 199-294
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000225
Family I set domains 0.00058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000001861   Gene: ENSNLEG00000001479   Transcript: ENSNLET00000001968
Sequence length 1010
Comment pep:known_by_projection supercontig:Nleu1.0:GL397418.1:523859:658650:1 gene:ENSNLEG00000001479 transcript:ENSNLET00000001968 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPAPLPLPLPLPLPLPLPLLLGLFLPAVWSRAITEAREEAKPYPLFLGPFPGSLQTDHT
PLLSLPHASGYQPALMFSPTQPGRPHTGNVAIPRVTSVESKPLPPLAFKHTVGHIILSEH
KGVKFNCSISVPNVYQDTTISWWKDGKELLGAHHAITQFYPDDEVTAIIASFSITSVQRS
DNGSYICKMKINNEEIVSDPIYIEVQGLPHFTKQPESMNVTRNTAFNLTCQAVGPPEPIN
IFWVQNSSRVNEQPEKSPSVLTVPGLTEMAVFSCEAHNDKGLTVSKGVQINIKAIPSPPT
EVSIRNSTAHSILISWVPGFDGYSPFRNCSIQVKEADPLSNGSVMIFNTSASPHLYQIKQ
LQALANYSIGVSCMNEIGWSAVSPWILASTTEGAPSVAPLNVTVFLNESNDNVDIRWMKP
PTKRQDGELVGYRISHVWQGAGISKELLEEVGQNGSRAQISVQVHNATCTVRIAAVTKGG
VGPFSDPVKIFIPAHGWVDYAPSSTPAPGNADPVLIIFGCFCGFILIGLVLYISLAIRKR
VQETKFGNAFTEEDSELVVNYIAKKSFCRRAIELTLRSLGVSEELQNKLEDVVIDRNILI
LGKILGEGEFGSVMEGNLKQEDGTSQKVAVKTMKLDNFSQREIEEFLSEAACMKDCHSTL
FVISGVCIEMSSQGIPKPMVILPFMKYGDLHTYLLYSRLETGPKHIPLQTLLKFMVDIAL
GMEYLSNRNFLHRDLAARNCMLRDDMTVCVADFGLSKKIYSGDYYRQGRIAKMPVKWIAI
ESLADRVYTSKSDVWAFGVTMWEIATRGMTPYPGVQNHEMYDYLLHGHRLKQPEDCLDEL
YEIMYSCWRTDPLDRPTFSVLRLQLEKLLESLPHVRNQADVIYVNTQLLEGSEGLAQGST
LAPLDLNIDPDSIIASCTPRAAISVVTAEIHDSKPHEGRYILNGGSEEWEDLTSAPSAAV
TAEKNSVLPVERPVRNGVSWSHSSTLPLGSSLPDELLFADDSSEGSEVLM
Download sequence
Identical sequences ENSNLEP00000001861

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]