SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000001907 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000001907
Domain Number 1 Region: 64-138
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000349
Family I set domains 0.013
Further Details:      
 
Domain Number 2 Region: 246-321
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000308
Family I set domains 0.014
Further Details:      
 
Domain Number 3 Region: 2-51
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000218
Family I set domains 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000001907   Gene: ENSNLEG00000001612   Transcript: ENSNLET00000002018
Sequence length 481
Comment pep:known_by_projection supercontig:Nleu1.0:GL397417.1:96474:112252:-1 gene:ENSNLEG00000001612 transcript:ENSNLET00000002018 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HERMQLSKDGKILTIIVQREDSGTYQCEARNAILSQSSDPIFLDVNYGPDPVEIKLESGV
ASGEVVEVMEGSNVTFLAETKSHPPSAYTWFLLDSILSHTTRTFTIHAVSREHEGLYRCL
VSNSATHLSRLGTLKVQVLGESPFPVPLLRSSERVLNPGPLDTVCRSQGQEIETTLANTE
KPPTPIPQSLRRTQGDFQCSRALTAGKAGHTGSFAWLGTSSTRPRWLSRDGPDQVNITRE
LASEMISTIEAELNSSLTLQCWAESKPGAEYRWTLEHSTAEHLGEQLIIRALTWEHDGIY
NCTASNSLTGLARSASVLVKVVGPQSSSLSSRAIAGIVIGILAVIAVASELGYFLYIRNA
RRPSRKTTEDPSHETSQPTPEEEHPTEPSSESLSPEYCNISQLQGRIRVEMVKPEQIPST
LWTKLPSASPGGNSFSPWKPPPKPLMPPLKLLSTVPKNMESIYEELVNPEPNTYVQINPS
V
Download sequence
Identical sequences ENSNLEP00000001907 ENSNLEP00000001907

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]