SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000001922 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000001922
Domain Number 1 Region: 250-291
Classification Level Classification E-value
Superfamily CCCH zinc finger 2.49e-16
Family CCCH zinc finger 0.001
Further Details:      
 
Domain Number 2 Region: 222-248
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000000103
Family CCCH zinc finger 0.0013
Further Details:      
 
Domain Number 3 Region: 195-219
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000000772
Family CCCH zinc finger 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000001922   Gene: ENSNLEG00000001619   Transcript: ENSNLET00000002032
Sequence length 294
Comment pep:known_by_projection supercontig:Nleu1.0:GL397418.1:865584:889399:-1 gene:ENSNLEG00000001619 transcript:ENSNLET00000002032 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDFENLFSKPPNPALGKTATDSDERIDDEIDTEVEETQEEKIKLECEQIPKKFRHFGNSA
ISPKSSLRRKSRSKDYDVYSDNDICSQESEDNFAKELQQYIQAREMANAAQPEESTKKER
VKDTPQAAKQKNKNLKAGHKNGKQKKMKRKWPGTGNKGSNALLRNSGSQEEDGKPKEKQQ
HLSQAFINQHTVERKGKQICKYFLERKCIKGDQCKFDHDAEIEKKKEMCKFYVQGYCTRG
ENCLYLHNEYPCKFYHTGTKCYQGEYCKFSHAPLTAETQELLAKVLDTEKKSCK
Download sequence
Identical sequences G1QLV6
ENSNLEP00000001922 XP_003277723.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]