SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Home > Genomes > Nomascus leucogenys 76_1.0 > ENSNLEP00000001924

Domain assignment for ENSNLEP00000001924 from Nomascus leucogenys 76_1.0

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:	ENSNLEP00000001924
Domain Number 1	Region: 139-211
Classification Level	Classification	E-value
Superfamily	Immunoglobulin	0.0000000000000541
Family	I set domains	0.016
Further Details:

Domain Number 2	Region: 42-132
Classification Level	Classification	E-value
Superfamily	Immunoglobulin	0.0000000000309
Family	I set domains	0.016
Further Details:

Domain Number 3	Region: 6-46
Classification Level	Classification	E-value
Superfamily	Immunoglobulin	0.00000994
Family	I set domains	0.063
Further Details:

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function
Biological Process
Cellular Component

Biological Process	IC (bits)	H-Score

Cellular Component	IC (bits)	H-Score

Molecular Function	IC (bits)	H-Score

Protein sequence

External link(s)	Protein: ENSNLEP00000001924 Gene: ENSNLEG00000001621 Transcript: ENSNLET00000002034
Sequence length	268
Comment	pep:novel supercontig:Nleu1.0:GL397417.1:123537:140384:-1 gene:ENSNLEG00000001621 transcript:ENSNLET00000002034 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	MWEGQTLFMPSLSRAHSGVYTCKASNSISGLHSSVDTIITVSETLPQPNVTASNLAPVEH VASISLHCLSLRSTVAIHRYVNGQKLFVGGHREVSLDCRTLTLWNITRNDTGVYQCESWN SATSSISNPTLVKVIYGSDPHMVNPPDPEVTAGAALTLSCFADSNPPAQYHWEMDRRPGP ATQHLVISEVTLDQEGRYTCEASNSLTHLRGSVNGKIWISEVPGDGLQPALLRATIPAGG IAGIALGVLISVVLTGTAGYFVGVIRSQ
Download sequence
Identical sequences	ENSNLEP00000001924

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]