SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000001936 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000001936
Domain Number 1 Region: 7-70
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000195
Family I set domains 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000001936   Gene: ENSNLEG00000001635   Transcript: ENSNLET00000002046
Sequence length 135
Comment pep:known_by_projection supercontig:Nleu1.0:GL397417.1:175269:186805:1 gene:ENSNLEG00000001635 transcript:ENSNLET00000002046 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VIQSELNYSVILQWVVTMDPEPVLSWTFSGVPCGMGEKLFIRRLSWEQLGTYMCIATNSK
KQLVSETVTISLPKPVVQPTEAEPMELDPTLSLSGGSAIGLLAAGILGARTLIGGMCFTI
IQSLRTDRQKIGICS
Download sequence
Identical sequences ENSNLEP00000001936 ENSNLEP00000001936

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]