SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000001949 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000001949
Domain Number 1 Region: 208-263
Classification Level Classification E-value
Superfamily CCCH zinc finger 4.06e-20
Family CCCH zinc finger 0.00026
Further Details:      
 
Domain Number 2 Region: 180-206
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000000301
Family CCCH zinc finger 0.0014
Further Details:      
 
Domain Number 3 Region: 153-177
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000000183
Family CCCH zinc finger 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000001949   Gene: ENSNLEG00000001631   Transcript: ENSNLET00000002059
Sequence length 1069
Comment pep:known_by_projection supercontig:Nleu1.0:GL397418.1:937871:972537:1 gene:ENSNLEG00000001631 transcript:ENSNLET00000002059 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSKKGQHNKKFKNKEYDEYSTYSDDNFGNYSDDNFGNYGQETDEDFANQLKQYRQAKET
SNIALGSSFSKESGKKQRMKGVQQGIEQRVKSFNVCRGRGLPKKIKRKERGGRTNKGPNV
FSVSDDFQEYSKPGKKWKVMTQEFINQHTVEHKGKQICKYFLEGRCIKGDQCKFDHDAEL
EKRKEICKFYLQGYCTKGENCIYMHNEFPCKFYHSGAKCYQGDNCKFSHDDLTKETKKLL
DKVLNTDEELINEDERELEELRKRGITPLPKPPPGVGLLPTPPEHFPFSDPEDDFQTDFS
DDFRKIPSLFEIVVKPTVDLAHKIGRKPPAFYNSASPPGPQFQGSSPHPQHIYSSESSPG
PGPNMSQGHSSPVMHPGSPGHHPCAGPPGLPVPQSPPLPPGPPEIVGPQNQAGILVQPDT
SLTPPSMGGAYHSPGFPGHVMKVPRENHCSPGSSYQQSPGEMQLNTNYESLQNPAEFYDN
YYAQHSVHNFQPPSNSGDGMWHGEFAQQQPPIVQDSPNHGSGSEGSSTRTGHGPLPVPGL
LPAVQRALFVRLTQRYQEDEEQTSTQPHRAPSKEVDDTVNWYSSSEEEEGSSVKSILKTL
QKQTETLRNQQQPSTELSTPTDPRLAKEKSKGNQVVDPRLRTIPRQDIRKPSESAPVDLR
LAWDPRKLRGNGSGHVGSSVGGAKFDLHHANAGTNVKHKRGDDDDEDTERELREKAFLIP
LDASPGIMLQDPRSQLRQFSHIKMDITLTKPNFAKHIVWAPEDLLPVPLPKPDPVSSINL
PLPPLIADQRLNRLWNTKSDLHQNTVSIDPKLAAKAKINTTNREGYLEQFGDSHSSGAKL
GDPRLQKNFDPRLHRLPNTESHQVVMKDSHTSKGALHLARSNPGSSQPSGAGTSNSGSGA
LPPYAPKLSSSAGLPLGTSTSVLSGISLYDPRDHGSSSTSELATASSGENSKNQKKSGGL
KSSDKNEPSPGEAILPQKTNPNVEVTLDGPADPQADVPRSSGKVQVPAVHSLPVQALTGL
IRPQYSDPRQARQPGQGSPTPDNDPGRETDDKSLKEVFKTFDPTASPFC
Download sequence
Identical sequences ENSNLEP00000001949

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]