SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000001962 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000001962
Domain Number 1 Region: 382-671,780-822
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.94e-70
Family FAD-linked reductases, N-terminal domain 0.00027
Further Details:      
 
Domain Number 2 Region: 656-770
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 3.73e-25
Family L-aminoacid/polyamine oxidase 0.00025
Further Details:      
 
Domain Number 3 Region: 272-378
Classification Level Classification E-value
Superfamily Homeodomain-like 8.96e-20
Family SWIRM domain 0.014
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000001962
Domain Number - Region: 61-105
Classification Level Classification E-value
Superfamily RING/U-box 0.0226
Family RING finger domain, C3HC4 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000001962   Gene: ENSNLEG00000001591   Transcript: ENSNLET00000002072
Sequence length 823
Comment pep:known_by_projection supercontig:Nleu1.0:GL397291.1:9058508:9126516:1 gene:ENSNLEG00000001591 transcript:ENSNLET00000002072 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATPRGRTKKKASFDHSPDSLPLRSSGRQAKKKATETTDEDEDGGSEKKYRKCEKAGCTA
TCPVCFASASERCAKNGYTSRWYHLSCGEHFCNECFDHYYRSHKDGYDKYTTWKKIWTSN
GKTEPSPKAFMADQQLPYWVQCTKPECRKWRQLTKEIQLTPQIAKTYRCGMKPNTAIKPE
TSDHCSLPEDLRVLEVSNHWWYSMLILPPLLKDSVAAPLLSAYYPDCVGMSPSCTSTNRA
AATGNASPGKLEHSKAAPSVHVPGMNRYFQPFYQPNECGKALCVRPDVMELDELYEFPEY
SRDPTMYLALRNLILALWYTNCKEALTPQKCIPHIIVRGLVRIRCIQEVERILYFMTRKG
LINTGVLSVGADQYLLPKDYHNKSVIIIGAGPAGLAAARQLHNFGIKVTVLEAKDRIGGR
VWDDKSFKGVTVGRGAQIVNGCINNPVALMCEQLGISMHKFGERCDLIQEGGRITDPTID
KRMDFHFNALLDVVSEWRKDKTQLQDVPLGEKIEEIYKAFIKESGIQFSELEGQVLQFHL
SNLEYACGSNLHQVSARSWDHNEFFAQFAGDHTLLTPGYSVIIEKLAEGLDIRLKSPQVQ
SIDYSGDEVQVTTTDGTGYSAQKVLVTVPLALLQKGAIQFNPPLSEKKMKAINSLGAGII
EKIALQFPYRFWDSKVQGADFFGHVPPSASKRGLFAVFYDMDPQKKHSVLMSVIAGEAVA
SVRTLDDKQVLQQCMATLRELFKEQEVPDPTKYFVTRWSTDPWIQMAYSFVKTGGSGEAY
DIIAEDIQGTIFFAGEATNRHFPQTVTGAYLSGVREASKIAAF
Download sequence
Identical sequences ENSNLEP00000001962 ENSNLEP00000001962

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]