SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000001971 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000001971
Domain Number 1 Region: 36-140
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000106
Family V set domains (antibody variable domain-like) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000001971   Gene: ENSNLEG00000026759   Transcript: ENSNLET00000002082
Sequence length 300
Comment pep:known_by_projection supercontig:Nleu1.0:GL397417.1:219876:231859:1 gene:ENSNLEG00000026759 transcript:ENSNLET00000002082 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEIPMGTQGCFSKSLLLSASILVLWMLQGSQAALHIQKIPEQPQKNQDLLLLVQGVPDTF
QDFNWYLGEETYGGTRLFTYIPGIQRPQRDGSAMGQRDIVGFPNGSMLLRRAQPADSGTY
QVAVTINSEWTMKAKTEVQVAEKNKELPSTYLPTNAGILAATIIGSLAAGALLISCVAYL
LVTRNWRGQSHRYRAPRHPSPVSSHCLLKPPYQFPPCVPRMATTEKPELGPAHDAGDNNI
YEVMPSPVLLVSPISDTRSINPALPLPTPPPLQAGPENHQYQQDLLNPDPAPYCQLVPTS
Download sequence
Identical sequences ENSNLEP00000001971

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]