SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000001978 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000001978
Domain Number 1 Region: 94-180
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000116
Family I set domains 0.036
Further Details:      
 
Domain Number 2 Region: 17-96
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000458
Family C1 set domains (antibody constant domain-like) 0.023
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000001978
Domain Number - Region: 187-233
Classification Level Classification E-value
Superfamily Obg GTP-binding protein N-terminal domain 0.0262
Family Obg GTP-binding protein N-terminal domain 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000001978   Gene: ENSNLEG00000026567   Transcript: ENSNLET00000002089
Sequence length 378
Comment pep:known_by_projection supercontig:Nleu1.0:GL397417.1:407050:424838:1 gene:ENSNLEG00000026567 transcript:ENSNLET00000002089 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AKPENQAEAQKVTFSQDPTTVALCISKEGRPPARISWLSSLDWEAKETQVSGTLAGTVTV
TSRFTLVPSGRADGVTVTCKVEHESFEEPALIPVTLSVRYPPEVSISGYDDNWYLGRTDA
TLSCDVRSNPEPTGYDWSTTSGTFPTSAVAQGSQLVIHAVDSLFNTTFVCTVTNAVGMGR
AEQVIFVRGEKSSGGGGGGGGGGGGGGGAVATGDSTIRKLRRRRKRRQRKASSLEDDMDL
EGPPSYKPPTPKAKLEEQEMPSQLFTLGASEHSPLKTPYFDAGASCTEQEMPRYHELPTL
EERSGPLHPGATSLGSPIPVPPGPPAVEDVSLDLEDEEGEEEEEYLDKINPIYDALSYSS
PSDSYQGKGFVMSRAMYV
Download sequence
Identical sequences ENSNLEP00000001978

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]