SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000001981 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000001981
Domain Number 1 Region: 183-277
Classification Level Classification E-value
Superfamily Immunoglobulin 1.4e-19
Family I set domains 0.0096
Further Details:      
 
Domain Number 2 Region: 90-190
Classification Level Classification E-value
Superfamily Immunoglobulin 1.2e-17
Family I set domains 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000001981   Gene: ENSNLEG00000001664   Transcript: ENSNLET00000002092
Sequence length 354
Comment pep:known_by_projection supercontig:Nleu1.0:GL397530.1:282034:288630:-1 gene:ENSNLEG00000001664 transcript:ENSNLET00000002092 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PGAGQEVQTENVTVAEGGVAEITCRLHQYDGSIVVIQNPARQTLFFNGTRALKDERFQLE
EFSPRRLDRFEPTFVPSLSPTSLLPAAVAPENPVVEVREQAVEGGEVELSCLVPRSRPAA
TLRWYRDRKELKGVSSSQENGKVWSVASTVRFRVDRKDDGGIIICEAQNQALPSGHSKQT
QYVLDVQYSPTARIHASQAVVREGDTLVLTCAVTGNPRPNQIRWNRGNESLPERAEAVGE
TLTLPGLVSADNGTYTCEASNKHGHARALYVLVVYDPGAVVEAQTSVPYAIVGGILALLV
FLIICVLVGMVWCSVRQKGSYLTHEASGLDEQGEAREAFLNGSDGHKRKEEFFI
Download sequence
Identical sequences ENSNLEP00000001981 ENSNLEP00000001981

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]