SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000001996 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000001996
Domain Number 1 Region: 683-710
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000204
Family CCCH zinc finger 0.0033
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000001996
Domain Number - Region: 740-760
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0267
Family CCCH zinc finger 0.0038
Further Details:      
 
Domain Number - Region: 709-734
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0769
Family CCCH zinc finger 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000001996   Gene: ENSNLEG00000001681   Transcript: ENSNLET00000002107
Sequence length 958
Comment pep:known_by_projection supercontig:Nleu1.0:GL397508.1:736715:841906:-1 gene:ENSNLEG00000001681 transcript:ENSNLET00000002107 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSRGPGRASRTREMEEKEILRRQIRLLQGLIDDYKTLHGNAPAPGTPAASGWQPPTYHS
GRAFSARYPRPSRRGYSSHHGPSWRKKYSLVNRPPGPSDPPADHAVQPLHGARGGQAPVP
QQHVLERQVQLSQGQNVVIKVKPPSKSGSASASGAQRGSLEEYEDTAWSDQRPREGEGEP
PRGQLQPSRPARARGTCSVEDPLLVCQKEAGKPRVLTSVGSVGDGPRELRRTVSESVITV
KASFPSSALPPRTDVALGRKLGSHSVASCAPQLLGDRRVDAGHADQPVPSGSVGGPARPA
SGPRQAREASLVVTCRTNKFRKNNYKWVAASAKSPRAARRALSPRVAAENVCKASAGTAD
KMEKLQLIADPEPKPRKPATSSKPGSAPSKYKWKASSPSASSSSSFHWQSEAGSKDHASQ
LSPVLSRSPSGDRPAVGLSGLKPLSGETPLSAYKVKSRTKIIRRRGSTSLPGDKKSSTSP
ATTAKSHLSLRRRQALRGKSSPVLKKTPNKGLVQVTTHRLCRLPPSRAHLPTKEASSLHA
MRTPPTSKVIKTRYRIVKKTPASPLSAPPFPLSLPSWRARRLSLSRSLVLNRLRPVASGG
GKAQPSSPRWRSKGYRCIGGVLYKVSANKLSKTSGQPGDAGSRPLLRTGRLDPAGSCSRS
LASRAVQRSLAIIRQARQRREKRKEYCMYYNRFGRCNRGERCPYIHDPEKVAVCTRFVRG
TCKKTDETCPFSHHVSXXXMPVCSYFLKGICSNSNCPYSHVYVSRKAEVCSDFLKGYCPL
GAKVRGPWGPEWAGFLXXXXXXXXAQCQLLHRTQKCHSRRAATSPAPGPSDAAARSRASA
SHGPRKPSAAQRPTRQTPSSPALTAAALAAPPHSPGGSASPSSSKASSSSSPPTSLDHEA
PSLQEAALAAARSSRLCKLPSFISLQSSPSPGAQPRVRAPRAPLIKDSGKPLHIKPRL
Download sequence
Identical sequences ENSNLEP00000001996

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]