SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000002003 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000002003
Domain Number 1 Region: 2-90
Classification Level Classification E-value
Superfamily Subtilisin-like 6.81e-22
Family Subtilases 0.0000268
Further Details:      
 
Domain Number 2 Region: 235-328
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000942
Family Growth factor receptor domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000002003   Gene: ENSNLEG00000001682   Transcript: ENSNLET00000002114
Sequence length 390
Comment pep:known_by_projection supercontig:Nleu1.0:GL397406.1:1313801:1317193:-1 gene:ENSNLEG00000001682 transcript:ENSNLET00000002114 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ITTDLHHRCTDRHTGTSASAPLAAGMIALALEANPFLTWRDMQHLVVRASKPAHLQAEDW
RTNGVGRQVSHHYGYGLLDAGLLVDTARTWLPTQPQRKCAVRVQSRPTETPACPSAITAG
GVGGRPEASLALVTPLRKGFPVAFSKRTCTQVVTREMVDRRTVGVQFPESCGPVQGPAWE
LKGREPGDSQDQAAKSLLLLCPPATCPGTLYHYTLLLYGTAEDMTARPTGPQVTSSACVQ
RDTEGLCQACDGPAYILGQLCLAYCPPRFFNHTRLVTARPGHMAAPALRVCSSCHASCYT
CRGGSPRDCTSCPPPSTLDQQQGSCVGPTTPDRHPWLRAAACPHHRCPASAMVLGLLAMT
LGGPVLCGMSMDLPPYWLSRARATPVKPQV
Download sequence
Identical sequences ENSNLEP00000002003 ENSNLEP00000002003

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]