SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000002034 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000002034
Domain Number 1 Region: 250-318
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000398
Family Laminin-type module 0.041
Further Details:      
 
Domain Number 2 Region: 379-428
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000837
Family Laminin-type module 0.0065
Further Details:      
 
Domain Number 3 Region: 431-478
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000212
Family Laminin-type module 0.0059
Further Details:      
 
Domain Number 4 Region: 316-368
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000502
Family Laminin-type module 0.037
Further Details:      
 
Domain Number 5 Region: 534-581
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000474
Family Laminin-type module 0.022
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000002034
Domain Number - Region: 481-516
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000117
Family Laminin-type module 0.032
Further Details:      
 
Domain Number - Region: 94-165
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00176
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.071
Further Details:      
 
Domain Number - Region: 784-798,833-914
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0131
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.019
Further Details:      
 
Domain Number - Region: 1016-1144
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0387
Family FCH domain 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000002034   Gene: ENSNLEG00000001675   Transcript: ENSNLET00000002147
Sequence length 1171
Comment pep:known_by_projection supercontig:Nleu1.0:GL397352.1:3428533:3466623:-1 gene:ENSNLEG00000001675 transcript:ENSNLET00000002147 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTPLFLLSFALPGLLHAQQDCSRGACYPPVGDLLVGRTRFLRASSTCGLTKPETYCTQYG
EWQMKCCKCDSRQPHNYYSHRVENVASSSGPMRWWQSQNDVNPVSLQLDLDRRFQLQEVM
MEFQGPMPAGMLIERSSDFGKTWRVYQYLAADCTSTFPRVRQGRPQSWQDVRCQSLPQRP
NARLNGGKVQLNLMDLASGIPATQSQKIQELGEITNLRVNFTRLAPVPQRGYHPPSAYYA
VSQLRLQGSCFCHGHADRCAPKPGASAGPSTAVQVHDVCVCQHNTAGPNCERCAPFYNNQ
PWRPAEGQDAHECQRCDCNGHSETCHFDPAVFAASQGAYGGVCDNCRDHTEGKNCERCQL
HYFRNRRPGVSIQETCIPCECDPDGAVPGAPCDPVTGQCVCKEHVQGERCDLCKPGFTGL
TYANPQGCHRCDCNILGSRRDMPCDEESGHCLCLPNVVGPKCDQCAPYHWKLASGQGCEP
CACDPHNSLSPQCNQFTGQCPCREGFGGLTCSAAAIRQCPDRTYGDAATGCRACDCDFRG
TEGPGCDKASGRCLCRPGLTGSRCDQCQRGYCNRYPVCVACHPCFQTYDADLREQALRLG
SLRNATTSLWSGPRLEDRGLASRILDAKSKIEQIRAVLSSAAVTEQEVAQVASAILSLRR
TLQGLQPDLPLEEEMLSLPRDLESLDRTFNGLLTMYQRKREQFEKISSADPSGAFRMLTT
AYEQSAQAAQQVSDSSRLLDQLRDSRREAERLVRQAGGGGGAGSPKLVALRLEMSSLPDL
TPTFNKLCGNSRQMACTPVSCPGELCPQDNGTACGSHCKGVLPRAGGAFLMAGQVAEQLR
GFNAQLQQTRQMIRAAEESASQIQSNAQRLETQVSASRSQMEEDVRRMRLLIQQVRDFLT
DPDTDAATIQEVSESVLALWLPTDSATVLQKMNEIQAIAARLPNVDLVLSQTKQDIARAR
RLQAEAEEARYPWALNFSLPRISLAFCSSTLLLGEGFGLALGLGWDAEGRGERWAIVQQV
LRPAEKLVTSMTKQLGDFWTRMEELRRQARQQGAEAVQAQQLAEGASEQALSAQEGFERI
KQKYAELKDRLGQSPMLGEQGARIQNVKTEAEELFGETMEMMDRMKDMESELLRGSQAIM
LRSADLTGLEKRVEQIRDHINGRVLYYATCK
Download sequence
Identical sequences ENSNLEP00000002034 ENSNLEP00000002034

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]