SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000002056 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000002056
Domain Number 1 Region: 202-373
Classification Level Classification E-value
Superfamily Fibronectin type III 1.85e-18
Family Fibronectin type III 0.0024
Further Details:      
 
Domain Number 2 Region: 29-190
Classification Level Classification E-value
Superfamily Fibronectin type III 3.71e-18
Family Fibronectin type III 0.0025
Further Details:      
 
Domain Number 3 Region: 372-539
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000279
Family Fibronectin type III 0.0067
Further Details:      
 
Domain Number 4 Region: 541-616
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000131
Family Fibronectin type III 0.005
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000002056
Domain Number - Region: 631-702
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00243
Family Fibronectin type III 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000002056   Gene: ENSNLEG00000001701   Transcript: ENSNLET00000002169
Sequence length 734
Comment pep:known_by_projection supercontig:Nleu1.0:GL397313.1:4098116:4130638:1 gene:ENSNLEG00000001701 transcript:ENSNLET00000002169 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFYVCSSCVFLYGSNFLNFPFQVAPAKSAPEIPTIDQAYSKLSNSITVEWATVPGATSYL
LTAEDGDTVIETMVANSPGTVTGLKAATLYEITIRSISAAGRSQASPPKQAKTVLAAPIL
EVNSPSSDSILVQWEAVYMAIGFSVSIMRANGLGSIWKENTTNTSLTFTSLEAGTLYTIK
AYAWNANGIPGDDSTCNQRTSPRAPANIQVSFDSGDLKASFSWALAEGAFNYTVMALSDS
SELTCSTTFSSCTISSLQCGTEYSISVLASNDAGSSKSSSAVTLKTVACAPGRVTIQEDP
PGHLSVAWSNVDLGDYYVVFVKSDDGLEVHCNTSLTQCNFLSECGFTYFISVFAYNKAGQ
SPLGDIFNYTTAPCCPSDINPVLVSSDTVEIVWSPVRGAELYETKAVDGYNMVECNDTAP
ACTLSALECDTKYNITVYSFSEVRGSNMSCTPQFITTAPCSPEIKNVSRDAFSMINVHWR
STNDDATYTVTAQGEKGLYQCSSMGESCTMRGLPCGSVFSVTAVAETQAGRSLPSYSVPL
ETVPCCPTGLTVTQITQSVINVSWTIGRVAQTHVAVLESHTGQSKCHTHQNHCLLGCITC
GINYTVTLKAISATGLTADCSYQSYFSGACCPLGVKLYRLGPNGIRIYWQASSGSANYST
DLYGSKGIFTCTPSAGLSFCDVTDIPCGDVYTVMVSPVAETGLKLTFCPKKIYSVTCSGS
TLGMVIYRGKRNEE
Download sequence
Identical sequences ENSNLEP00000002056 ENSNLEP00000002056

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]