SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000002062 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000002062
Domain Number 1 Region: 10-116
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000000316
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.00011
Further Details:      
 
Domain Number 2 Region: 311-356
Classification Level Classification E-value
Superfamily RING/U-box 0.000000294
Family RING finger domain, C3HC4 0.011
Further Details:      
 
Domain Number 3 Region: 248-285
Classification Level Classification E-value
Superfamily SAP domain 0.0000549
Family SAP domain 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000002062   Gene: ENSNLEG00000001710   Transcript: ENSNLET00000002176
Sequence length 363
Comment pep:known_by_projection supercontig:Nleu1.0:GL397432.1:994566:1040679:-1 gene:ENSNLEG00000001710 transcript:ENSNLET00000002176 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWATCCNWFCLDGQPEEVPPPQGARMQAYSNPGYSSFPSPTGLEPSCKSCGAHFANTARK
QTCLDCKKNFCMTCSSQLGNGPRLCLLCQRFRATAFQREELMKMKVKDLRDYLSLHDIST
EMCREKEELVLLVLGQQPIISQEDRTRASTLSPDFPEQQAFLTQPQSSMVPPTSPNLPSS
SAQATSVPPAQVQENQQANGHVSEDQEEPVYLESVARAPAEDETQSIDSEDSFVPGRRAS
LSDLTDLEDIEGLTVRQLKEILARNFVNYKGCCEKWELMERVTRLYKDQKGLQHLVSGAE
DQNGGAVPSGLEENLCKICMDSPIDCVLLECGHMVTCTKCGKRMNECPICRQYVIRAVHV
FRS
Download sequence
Identical sequences G1QM96
ENSNLEP00000002062 XP_003278420.1.23891 XP_003278421.1.23891 ENSNLEP00000002062

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]