SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000002079 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000002079
Domain Number 1 Region: 109-209
Classification Level Classification E-value
Superfamily Snake toxin-like 3.14e-44
Family Extracellular domain of cell surface receptors 0.00000178
Further Details:      
 
Domain Number 2 Region: 215-295
Classification Level Classification E-value
Superfamily Snake toxin-like 7.17e-19
Family Extracellular domain of cell surface receptors 0.0000162
Further Details:      
 
Domain Number 3 Region: 23-101
Classification Level Classification E-value
Superfamily Snake toxin-like 2.22e-16
Family Extracellular domain of cell surface receptors 0.0000149
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000002079   Gene: ENSNLEG00000001674   Transcript: ENSNLET00000002193
Sequence length 335
Comment pep:known_by_projection supercontig:Nleu1.0:GL397530.1:311120:338634:-1 gene:ENSNLEG00000001674 transcript:ENSNLET00000002193 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGHPLLLPLLLLLHTCVPASWGLRCMHCKSNGDCRVEECTLGQDLCRTTIVRMWEEGEEL
ELVEKSCTHSEKTNRTLSYRTGLKITSLTEVVCGLDLCNQGNSGRAVTYSRSRYLECISC
GSSDMSCERGRHQSLQCRSPEEQCLDVVTHWIREGEEGRPKDDRHLRGCGYLPGCPGSNG
FHNNDTFHFLKCCNTTKCNEGPILELENLPQNGRQCYSCQGNSTHGCSSEETFLIDCRGP
MNQCLVATGTYEPKNQSYMVRGCATASMCQHAHLGDAFSMNHINVSCCTKSGCNHPDLDV
QYRRGAAPQPGPAHLSLTITLLMTARLWGGTLLWT
Download sequence
Identical sequences G1QMB3
XP_003281245.1.23891 ENSNLEP00000002079 ENSNLEP00000002079

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]