SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000002183 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000002183
Domain Number 1 Region: 394-574
Classification Level Classification E-value
Superfamily ADP-ribosylation 1.08e-48
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.029
Further Details:      
 
Domain Number 2 Region: 261-361
Classification Level Classification E-value
Superfamily WWE domain 0.0000000000471
Family WWE domain 0.01
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000002183
Domain Number - Region: 73-96
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000837
Family CCCH zinc finger 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000002183   Gene: ENSNLEG00000001802   Transcript: ENSNLET00000002299
Sequence length 597
Comment pep:known_by_projection supercontig:Nleu1.0:GL397332.1:324741:360405:-1 gene:ENSNLEG00000001802 transcript:ENSNLET00000002299 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLLCRKNCRNSHSLTTEHNLSVLRTHGVDHLSYNELCQLLFQNDPWLLPEICQHYNKGDG
PHGSCAFQKQCIKLHICQYFLQGECKFGTSCKRSHDISNSENLEKLEKLGMSSDLVSRLP
TIYRNAHDIKNKSSASSRVPPPFVPQGTSERKDSPGSVSPNTLSQEESDQICLYHIRKSC
SFQDKCHRVHFHLPYRWQFLDRGKWKDLNNMELIEEAYCNPKIERILCSESASTFHSDCL
NFNAMTYGATQARRLSTASSVTKPPHFILTTDWIWYWSDEFGSWQEYGRQGTTHPVTTVS
SSDVEKAYLAYCSPGSDGQAATLKFQAGKHNYELDFKAFVQKNLVYGTTKKVCRRPKYVS
PQDVTTMQTCNTKFPGPKSIPDYWDSSALPDPGFQKITLSSSSEEYQKVWNLFNRTLPFY
FVQKIERVQNLALWEVYQWQKGQMQKQNGGKAVDERQLFHGTSAIFVDAICQQNFDWRVC
GVHGTSYGKGSYFARDAAYSHHYSKSDTQTHTMFLARVLVGEFVRGNASFVRPPAKEGQS
NAFYDSCVNSVSEPSIFVIFEKHQVYPEYLIQYTTSSKPSATPSILLALGSLFSSSK
Download sequence
Identical sequences ENSNLEP00000002183 ENSNLEP00000002183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]