SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000002191 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSNLEP00000002191
Domain Number - Region: 175-200
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00102
Family CCCH zinc finger 0.0034
Further Details:      
 
Domain Number - Region: 17-40
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0251
Family CCCH zinc finger 0.0039
Further Details:      
 
Domain Number - Region: 211-234
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0445
Family CCCH zinc finger 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000002191   Gene: ENSNLEG00000001722   Transcript: ENSNLET00000002308
Sequence length 354
Comment pep:known_by_projection supercontig:Nleu1.0:GL397347.1:413340:479960:-1 gene:ENSNLEG00000001722 transcript:ENSNLET00000002308 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTAVNVALIRDTKWLTLEVCREFQRGTCSRADADCKFAHPPRVCHVENGRVVACFDSLKG
RCTRENCKYLHPPPHLKTQLEINGRNNLIQQKTAAAMFAQQMQLMLQNAQMSSLGSFPMT
PSLPANPPMAFNPYIPHPGMGLVPAELVPNTPVLIPGNPPLAMPGAVGPKLMRSDKLEVC
REFQRGNCTRGENDCRYAHPTDASMIEASDNTVTICMDYIKGRCSREKCKYFHPPAHLQA
KLKAAHHQMNHSAASAMALQPGTLQLIPKRAALEKPNGATPVFNPTVFHCQQALTNLQLP
QPAFIPAGPILCMAPASNIVPMMHGATPTTVSAATTPATSVPFAAPTTGNQLKF
Download sequence
Identical sequences G1QMM5
ENSNLEP00000002191 ENSNLEP00000002191 XP_003272668.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]