SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000002231 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000002231
Domain Number 1 Region: 449-645
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.55e-47
Family SPRY domain 0.014
Further Details:      
 
Domain Number 2 Region: 385-478
Classification Level Classification E-value
Superfamily Fibronectin type III 3.17e-18
Family Fibronectin type III 0.0013
Further Details:      
 
Domain Number 3 Region: 169-230
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 1.68e-16
Family B-box zinc-binding domain 0.0013
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000002231
Domain Number - Region: 80-114
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00251
Family TFIIH p44 subunit cysteine-rich domain 0.069
Further Details:      
 
Domain Number - Region: 19-46
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.0795
Family Cytochrome c3-like 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000002231   Gene: ENSNLEG00000001870   Transcript: ENSNLET00000002353
Sequence length 656
Comment pep:known_by_projection supercontig:Nleu1.0:GL397308.1:765036:817433:1 gene:ENSNLEG00000001870 transcript:ENSNLET00000002353 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLPMVPAPPGSFAAAARGAACSSLSSSSSSITCPQCHRSASLDHRGLRGFQRNRLLEAIV
QRYQQGRGAAPGASAAAAVAICQLCDRTPPEPAATLCEQCDVLYCSACQLKCHPSRGPFA
KHRLVQPPPPPAPAEAASRPTGAAQGAPSGGGGCKSPGGAGAGATGGSTARKFPTCPEHE
MENYSMYCVSCRTPVCYLCLEEGRHAKHEVKPLGAMWKQHKAQLSQALNGVSDKAKEAKE
FLVQLKNILQQIQENGLDYEACLVAQCDALVDALTRQKAKLLTKVTKEREHKLKMVWDQI
NHCTLKLRQSTGLMEYCLEVIKENDPSGFLQISDALIKRVQVSQEQWVKGALEPKVSAEF
DLTLDSEPLLQAIHQLDFIQMKCRVPPIPLLQLEKCCTRNNSVTLAWRMPPFTHSPVDGY
ILELDDGAGGQFREVYVGKETLCTIDGLHFNSTYNARVKAFNSSGVGPYSKTVVLQTSDV
AWFTFDPNSGHRDIILSNDNQTATCSSYDDRVVLGTAAFSKGVHYWELHVDRYDNHPDPA
FGVARASVVKDMMLGKDDKAWAMYVDNNRSWFMHCNSHTNRTEGGVCKGATVGVLLDLNK
HTLTFFINGQQQGPTAFSHVDGVFMPALSLNRNVQVTLHTGLEVPTNLGRPKLSGN
Download sequence
Identical sequences G1QMR5
ENSNLEP00000002231 ENSNLEP00000002231

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]