SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000002255 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000002255
Domain Number 1 Region: 64-211
Classification Level Classification E-value
Superfamily C-type lectin-like 1.31e-42
Family C-type lectin domain 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000002255   Gene: ENSNLEG00000001828   Transcript: ENSNLET00000002377
Sequence length 215
Comment pep:known_by_projection supercontig:Nleu1.0:GL397301.1:254322:262917:1 gene:ENSNLEG00000001828 transcript:ENSNLET00000002377 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLEKPQSKLEGGVHSQLISWVIAVVFILLLSVCFIASCLVTHHNFSHCKRGTGVHKLEH
HAKLKCIKEKSELKSAEGSTWNCCPIDWRAFQSNCYFPLTDNKTWAESERNCSGMGAHLM
TISTEAEQNFIIQFLDRRLSYFLGLRDENAKGQWRWVDQTPFNPRRVFWHKNEPDNSQGE
NCVVLVYNQDKWAWNDVPCNSEARRICKIPGTTLN
Download sequence
Identical sequences G1QMT9
ENSNLEP00000002255 ENSNLEP00000002255 XP_003265492.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]