SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000002328 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000002328
Domain Number 1 Region: 140-453
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.2e-73
Family Papain-like 0.0000105
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000002328
Domain Number - Region: 83-142
Classification Level Classification E-value
Superfamily FnI-like domain 0.00931
Family Fibronectin type I module 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000002328   Gene: ENSNLEG00000001808   Transcript: ENSNLET00000002454
Sequence length 467
Comment pep:known_by_projection supercontig:Nleu1.0:GL397394.1:878285:888820:1 gene:ENSNLEG00000001808 transcript:ENSNLET00000002454 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWQCPLGLLLLLSLPGHVALGAQQGRGRRELAPGLHLRGIRDAGGRYCQEQDLCCRGRAD
DCALPYLGAICYCDLFCNRTVSDCCPDFWDFCLGVPPPFPPIQGCMHGGRIYPVLGTYWD
NCNRCTCQENRQWQCDQEPCLVDPDMIKAINQGNYGWQAGNHSAFWGMTLDEGIRYRLGT
MRPSSSVMNMHEIYTVLNPGEVLPTAFEASEKWPNLIHEPLDQGNCAGSWAFSTAAVASD
RVSIHSLGHMTPVLSPQNLLSCDTHQQQGCRGGRLDGAWWFLRRRGVVSDHCYPFSGRER
DEAGPAPPCMMHSRAMGRGKRQATAHCPNSHVNNNDIYQVTPVYRLGSNDKEVMKELMEN
GPVQALMEVHEDFFLYKGGIYSHTPVSLGRPERYRRHGTHSVKITGWGEETLPDGRTLKY
WTAANSWGPAWGERGHFRIVRGVNECDIESFVLGVWGRVGMEDMGHH
Download sequence
Identical sequences G1QN12
ENSNLEP00000002328 ENSNLEP00000002328 XP_003276396.1.23891 XP_012366793.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]