SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000002337 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000002337
Domain Number 1 Region: 296-361
Classification Level Classification E-value
Superfamily RING/U-box 3.74e-21
Family RING finger domain, C3HC4 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000002337   Gene: ENSNLEG00000001861   Transcript: ENSNLET00000002464
Sequence length 619
Comment pep:known_by_projection supercontig:Nleu1.0:GL397289.1:8720259:8775065:-1 gene:ENSNLEG00000001861 transcript:ENSNLET00000002464 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLGTIISAYRALSQPEASPGEPDQLTASLQPEPPVPARPSAGVPRARDVAQYLLSDSLFV
WVLVNTACCVLMLVAKLIQCIVFGPLRVSERQHLKDKFWNFIFYKFIFIFGVLNVQTVEE
VVMWCLWFAGLVFLHLMVQLCKDRFEYLSFSPTTPMSSHGRVLSLLVAMLLSCCGLAAVC
CITGYTHGMHTLAFMAAESLLVTVRTAHVILRYVIHLWDLNHEGTWEGKGTYVYYTDFVM
ELTLLSLDLMHHIHMLLFGNIWLSMASLVIFMQLRYLFHEVQRRIRRHKNYLRVVGNMEA
RFAVATPEELAVNNDDCAICWDSMQAARKLPCGHLFHNSCLRSWLEQDTSCPTCRMSLNI
ADNNRVREDHQGENLDENLVPVAAAEGRPRLNQHNHFFHFDGSRIASWLPSFSVEVMHTT
NILGITQASNSQLNAMAHQIQEMFPQVPYHLVLQDLQLTRSVEITTDNILEGRIQVPFPT
QRSDSIRPALNSPVEMPSSDQEEGETSAQTERVPLDLSPRLEETLDFGEVEVEPSEVEDF
EARGSRFSKSADERQRMLVQRKDELLQQARKRFLNKSSEDDAASESFLPSEGASSDPVTL
RRRMLAAAAERRLQKQQTS
Download sequence
Identical sequences ENSNLEP00000002337

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]